Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 176 (08 May 2019)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transmembrane protease serine 4

Gene

TMPRSS4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable protease. Seems to be capable of activating ENaC (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei245Charge relay systemBy similarity1
Active sitei290Charge relay systemBy similarity1
Active sitei387Charge relay systemBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Serine protease

Protein family/group databases

MEROPS protease database

More...
MEROPSi
S01.034

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protease serine 4 (EC:3.4.21.-)
Alternative name(s):
Channel-activating protease 2
Short name:
CAPH2
Membrane-type serine protease 2
Short name:
MT-SP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMPRSS4
Synonyms:TMPRSS3
ORF Names:UNQ776/PRO1570
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11878 TMPRSS4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606565 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NRS4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 32CytoplasmicSequence analysisAdd BLAST32
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei33 – 53Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini54 – 437ExtracellularSequence analysisAdd BLAST384

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56649

MalaCards human disease database

More...
MalaCardsi
TMPRSS4

Open Targets

More...
OpenTargetsi
ENSG00000137648

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
363969 Autosomal recessive cerebral atrophy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36579

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2331048

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMPRSS4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373304

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000886921 – 437Transmembrane protease serine 4Add BLAST437

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi64 ↔ 83By similarity
Disulfide bondi77 ↔ 92By similarity
Disulfide bondi127 ↔ 183By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi130N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi140 ↔ 193By similarity
Glycosylationi178N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi196 ↔ 310By similarity
Disulfide bondi230 ↔ 246By similarity
Disulfide bondi356 ↔ 372By similarity
Disulfide bondi383 ↔ 410By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei204 – 205CleavageSequence analysis2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NRS4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NRS4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NRS4

PeptideAtlas

More...
PeptideAtlasi
Q9NRS4

PRoteomics IDEntifications database

More...
PRIDEi
Q9NRS4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
82418
82419 [Q9NRS4-2]
82420 [Q9NRS4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NRS4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NRS4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High levels in pancreatic, gastric, colorectal and ampullary cancer. Very weak expression in normal gastrointestinal and urogenital tract.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000137648 Expressed in 129 organ(s), highest expression level in nasal cavity epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NRS4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NRS4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA006238

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121163, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NRS4, 13 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000477949

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9NRS4

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NRS4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini61 – 93LDL-receptor class AAdd BLAST33
Domaini94 – 204SRCRPROSITE-ProRule annotationAdd BLAST111
Domaini205 – 434Peptidase S1PROSITE-ProRule annotationAdd BLAST230

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3627 Eukaryota
COG5640 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182707

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000251822

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NRS4

KEGG Orthology (KO)

More...
KOi
K09635

Identification of Orthologs from Complete Genome Data

More...
OMAi
HCLACGE

Database of Orthologous Groups

More...
OrthoDBi
1314811at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NRS4

TreeFam database of animal gene trees

More...
TreeFami
TF351678

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00112 LDLa, 1 hit
cd00190 Tryp_SPc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.250.10, 1 hit
4.10.400.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036055 LDL_receptor-like_sf
IPR002172 LDrepeatLR_classA_rpt
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15494 SRCR_2, 1 hit
PF00089 Trypsin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00722 CHYMOTRYPSIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00192 LDLa, 1 hit
SM00202 SR, 1 hit
SM00020 Tryp_SPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50494 SSF50494, 1 hit
SSF56487 SSF56487, 1 hit
SSF57424 SSF57424, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50287 SRCR_2, 1 hit
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NRS4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLQDPDSDQP LNSLDVKPLR KPRIPMETFR KVGIPIIIAL LSLASIIIVV
60 70 80 90 100
VLIKVILDKY YFLCGQPLHF IPRKQLCDGE LDCPLGEDEE HCVKSFPEGP
110 120 130 140 150
AVAVRLSKDR STLQVLDSAT GNWFSACFDN FTEALAETAC RQMGYSSKPT
160 170 180 190 200
FRAVEIGPDQ DLDVVEITEN SQELRMRNSS GPCLSGSLVS LHCLACGKSL
210 220 230 240 250
KTPRVVGVEE ASVDSWPWQV SIQYDKQHVC GGSILDPHWV LTAAHCFRKH
260 270 280 290 300
TDVFNWKVRA GSDKLGSFPS LAVAKIIIIE FNPMYPKDND IALMKLQFPL
310 320 330 340 350
TFSGTVRPIC LPFFDEELTP ATPLWIIGWG FTKQNGGKMS DILLQASVQV
360 370 380 390 400
IDSTRCNADD AYQGEVTEKM MCAGIPEGGV DTCQGDSGGP LMYQSDQWHV
410 420 430
VGIVSWGYGC GGPSTPGVYT KVSAYLNWIY NVWKAEL
Length:437
Mass (Da):48,246
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3CF55633361A2BE7
GO
Isoform 2 (identifier: Q9NRS4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-151: Missing.

Note: No experimental confirmation available.
Show »
Length:432
Mass (Da):47,686
Checksum:iD5FAC7E40798790C
GO
Isoform 3 (identifier: Q9NRS4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MLQ → M

Note: No experimental confirmation available.
Show »
Length:435
Mass (Da):48,005
Checksum:i14B3AF624CE8BEA6
GO
Isoform 4 (identifier: Q9NRS4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3: MLQ → M
     14-53: LDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLI → LV

Note: No experimental confirmation available.
Show »
Length:397
Mass (Da):43,786
Checksum:i135A735A29AB457C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V124G3V124_HUMAN
Transmembrane protease serine 4
TMPRSS4 hCG_41152
335Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WTU6A0A087WTU6_HUMAN
Transmembrane protease serine 4
TMPRSS4
399Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBM5H0YBM5_HUMAN
Transmembrane protease serine 4
TMPRSS4
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIH1E5RIH1_HUMAN
Transmembrane protease serine 4
TMPRSS4
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ESG9E7ESG9_HUMAN
Transmembrane protease serine 4
TMPRSS4
290Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAX8H0YAX8_HUMAN
Transmembrane protease serine 4
TMPRSS4
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJR8E5RJR8_HUMAN
Transmembrane protease serine 4
TMPRSS4
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF31436 differs from that shown. Reason: Frameshift at position 31.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2L → V in AAF31436 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024293177R → Q. Corresponds to variant dbSNP:rs1894176Ensembl.1
Natural variantiVAR_046505198K → E. Corresponds to variant dbSNP:rs12270001Ensembl.1
Natural variantiVAR_046506208V → G5 PublicationsCorresponds to variant dbSNP:rs1941635Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0131161 – 3MLQ → M in isoform 3 and isoform 4. 2 Publications3
Alternative sequenceiVSP_05422914 – 53LDVKP…VVVLI → LV in isoform 4. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_013117147 – 151Missing in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF179224 mRNA Translation: AAF74526.1
AF216312 mRNA Translation: AAF31436.1 Frameshift.
AK172766 mRNA Translation: BAD18749.1
AK303173 mRNA Translation: BAH13911.1
AY358530 mRNA Translation: AAQ88894.1
EF445038 Genomic DNA Translation: ACA06088.1
AP000665 Genomic DNA No translation available.
AP002800 Genomic DNA No translation available.
BC004855 mRNA Translation: AAH04855.1
BC011703 mRNA Translation: AAH11703.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31684.1 [Q9NRS4-1]
CCDS44743.1 [Q9NRS4-2]
CCDS53716.1 [Q9NRS4-3]
CCDS53717.1 [Q9NRS4-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001077416.1, NM_001083947.1
NP_001167023.1, NM_001173552.1
NP_063947.1, NM_019894.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000437212; ENSP00000416037; ENSG00000137648 [Q9NRS4-1]
ENST00000522824; ENSP00000430547; ENSG00000137648 [Q9NRS4-2]
ENST00000523251; ENSP00000429209; ENSG00000137648 [Q9NRS4-4]
ENST00000534111; ENSP00000435184; ENSG00000137648 [Q9NRS4-3]
ENST00000618855; ENSP00000477949; ENSG00000137648 [Q9NRS4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56649

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56649

UCSC genome browser

More...
UCSCi
uc010rxo.3 human [Q9NRS4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF179224 mRNA Translation: AAF74526.1
AF216312 mRNA Translation: AAF31436.1 Frameshift.
AK172766 mRNA Translation: BAD18749.1
AK303173 mRNA Translation: BAH13911.1
AY358530 mRNA Translation: AAQ88894.1
EF445038 Genomic DNA Translation: ACA06088.1
AP000665 Genomic DNA No translation available.
AP002800 Genomic DNA No translation available.
BC004855 mRNA Translation: AAH04855.1
BC011703 mRNA Translation: AAH11703.1
CCDSiCCDS31684.1 [Q9NRS4-1]
CCDS44743.1 [Q9NRS4-2]
CCDS53716.1 [Q9NRS4-3]
CCDS53717.1 [Q9NRS4-4]
RefSeqiNP_001077416.1, NM_001083947.1
NP_001167023.1, NM_001173552.1
NP_063947.1, NM_019894.3

3D structure databases

SMRiQ9NRS4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121163, 5 interactors
IntActiQ9NRS4, 13 interactors
STRINGi9606.ENSP00000477949

Chemistry databases

BindingDBiQ9NRS4
ChEMBLiCHEMBL2331048

Protein family/group databases

MEROPSiS01.034

PTM databases

iPTMnetiQ9NRS4
PhosphoSitePlusiQ9NRS4

Polymorphism and mutation databases

BioMutaiTMPRSS4
DMDMi317373304

Proteomic databases

jPOSTiQ9NRS4
MaxQBiQ9NRS4
PaxDbiQ9NRS4
PeptideAtlasiQ9NRS4
PRIDEiQ9NRS4
ProteomicsDBi82418
82419 [Q9NRS4-2]
82420 [Q9NRS4-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
56649
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000437212; ENSP00000416037; ENSG00000137648 [Q9NRS4-1]
ENST00000522824; ENSP00000430547; ENSG00000137648 [Q9NRS4-2]
ENST00000523251; ENSP00000429209; ENSG00000137648 [Q9NRS4-4]
ENST00000534111; ENSP00000435184; ENSG00000137648 [Q9NRS4-3]
ENST00000618855; ENSP00000477949; ENSG00000137648 [Q9NRS4-1]
GeneIDi56649
KEGGihsa:56649
UCSCiuc010rxo.3 human [Q9NRS4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56649
DisGeNETi56649

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMPRSS4
HGNCiHGNC:11878 TMPRSS4
HPAiHPA006238
MalaCardsiTMPRSS4
MIMi606565 gene
neXtProtiNX_Q9NRS4
OpenTargetsiENSG00000137648
Orphaneti363969 Autosomal recessive cerebral atrophy
PharmGKBiPA36579

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00950000182707
HOGENOMiHOG000251822
InParanoidiQ9NRS4
KOiK09635
OMAiHCLACGE
OrthoDBi1314811at2759
PhylomeDBiQ9NRS4
TreeFamiTF351678

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMPRSS4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56649

Protein Ontology

More...
PROi
PR:Q9NRS4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000137648 Expressed in 129 organ(s), highest expression level in nasal cavity epithelium
ExpressionAtlasiQ9NRS4 baseline and differential
GenevisibleiQ9NRS4 HS

Family and domain databases

CDDicd00112 LDLa, 1 hit
cd00190 Tryp_SPc, 1 hit
Gene3Di3.10.250.10, 1 hit
4.10.400.10, 1 hit
InterProiView protein in InterPro
IPR036055 LDL_receptor-like_sf
IPR002172 LDrepeatLR_classA_rpt
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER
PfamiView protein in Pfam
PF15494 SRCR_2, 1 hit
PF00089 Trypsin, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00192 LDLa, 1 hit
SM00202 SR, 1 hit
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
SSF56487 SSF56487, 1 hit
SSF57424 SSF57424, 1 hit
PROSITEiView protein in PROSITE
PS50287 SRCR_2, 1 hit
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTMPS4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NRS4
Secondary accession number(s): A8MU84
, B0YJB0, B7Z8C5, E7ERX8, Q5XKQ6, Q6UX37, Q9NZA5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 11, 2011
Last modified: May 8, 2019
This is version 176 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again