Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 182 (07 Apr 2021)
Sequence version 2 (10 Jul 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Striatin-4

Gene

STRN4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.

Miscellaneous

The name 'Zinedin' probably originates from the name of the famous soccer player from Marseille (Zinedine Zidane).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9NRL3

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9NRL3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9NRL3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Striatin-4
Alternative name(s):
Zinedin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:STRN4
Synonyms:ZIN
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15721, STRN4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614767, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NRL3

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000090372.14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
29888

Open Targets

More...
OpenTargetsi
ENSG00000090372

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134863218

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NRL3, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
STRN4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
152031693

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000512391 – 753Striatin-4Add BLAST753

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei53PhosphoserineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei276PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NRL3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NRL3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NRL3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NRL3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NRL3

PeptideAtlas

More...
PeptideAtlasi
Q9NRL3

PRoteomics IDEntifications database

More...
PRIDEi
Q9NRL3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
29195
4874
82385 [Q9NRL3-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NRL3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NRL3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000090372, Expressed in testis and 200 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NRL3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NRL3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000090372, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CTTNBP2; this interaction may regulate dendritic spine distribution of STRN4. Activation of glutamate receptors weakens the interaction with CTTNBP2 (By similarity).

Interacts with CTTNBP2NL.

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
118941, 105 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NRL3, 86 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000375777

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NRL3, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati436 – 475WD 1Add BLAST40
Repeati489 – 528WD 2Add BLAST40
Repeati542 – 581WD 3Add BLAST40
Repeati587 – 628WD 4Add BLAST42
Repeati635 – 674WD 5Add BLAST40
Repeati677 – 716WD 6Add BLAST40
Repeati723 – 752WD 7Add BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni71 – 79Caveolin-bindingSequence analysis9
Regioni165 – 182Calmodulin-bindingSequence analysisAdd BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili69 – 136Sequence analysisAdd BLAST68

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi6 – 14Poly-Ala9

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat striatin family.Curated

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0642, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183095

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009108_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NRL3

Identification of Orthologs from Complete Genome Data

More...
OMAi
LQGMMSD

Database of Orthologous Groups

More...
OrthoDBi
334070at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NRL3

TreeFam database of animal gene trees

More...
TreeFami
TF313387

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020472, G-protein_beta_WD-40_rep
IPR013258, Striatin_N
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR019775, WD40_repeat_CS
IPR017986, WD40_repeat_dom
IPR036322, WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08232, Striatin, 1 hit
PF00400, WD40, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00320, GPROTEINBRPT

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320, WD40, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978, SSF50978, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678, WD_REPEATS_1, 1 hit
PS50082, WD_REPEATS_2, 4 hits
PS50294, WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NRL3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMEERAAAAV AAAASSCRPL GSGAGPGPTG AAPVSAPAPG PGPAGKGGGG
60 70 80 90 100
GGSPGPTAGP EPLSLPGILH FIQHEWARFE AEKARWEAER AELQAQVAFL
110 120 130 140 150
QGERKGQENL KTDLVRRIKM LEYALKQERA KYHKLKFGTD LNQGEKKADV
160 170 180 190 200
SEQVSNGPVE SVTLENSPLV WKEGRQLLRQ YLEEVGYTDT ILDMRSKRVR
210 220 230 240 250
SLLGRSLELN GAVEPSEGAP RAPPGPAGLS GGESLLVKQI EEQIKRNAAG
260 270 280 290 300
KDGKERLGGS VLGQIPFLQN CEDEDSDEDD ELDSVQHKKQ RVKLPSKALV
310 320 330 340 350
PEMEDEDEED DSEDAINEFD FLGSGEDGEG APDPRRCTVD GSPHELESRR
360 370 380 390 400
VKLQGILADL RDVDGLPPKV TGPPPGTPQP RPHEDVFIMD TIGGGEVSLG
410 420 430 440 450
DLADLTVTND NDLSCDLSDS KDAFKKTWNP KFTLRSHYDG IRSLAFHHSQ
460 470 480 490 500
SALLTASEDG TLKLWNLQKA VTAKKNAALD VEPIHAFRAH RGPVLAVAMG
510 520 530 540 550
SNSEYCYSGG ADACIHSWKI PDLSMDPYDG YDPSVLSHVL EGHGDAVWGL
560 570 580 590 600
AFSPTSQRLA SCSADGTVRI WDPSSSSPAC LCTFPTASEH GVPTSVAFTS
610 620 630 640 650
TEPAHIVASF RSGDTVLYDM EVGSALLTLE SRGSSGPTQI NQVVSHPNQP
660 670 680 690 700
LTITAHDDRG IRFLDNRTGK PVHSMVAHLD AVTCLAVDPN GAFLMSGSHD
710 720 730 740 750
CSLRLWSLDN KTCVQEITAH RKKHEEAIHA VACHPSKALI ASAGADALAK

VFV
Length:753
Mass (Da):80,596
Last modified:July 10, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i339AC24E26A9CD54
GO
Isoform 2 (identifier: Q9NRL3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-119: Missing.
     347-376: ESRRVKLQGILADLRDVDGLPPKVTGPPPG → GPELHSPTEWQGALSVGKASPMPDWVGTAG
     377-753: Missing.

Show »
Length:257
Mass (Da):28,106
Checksum:iA3898671C11A1A4C
GO
Isoform 3 (identifier: Q9NRL3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     384-384: E → EGSFGFSS

Show »
Length:760
Mass (Da):81,266
Checksum:i653E59DBCD215E42
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYK2F5GYK2_HUMAN
Striatin-4
STRN4
634Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZM0M0QZM0_HUMAN
Striatin-4
STRN4
317Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0W8M0R0W8_HUMAN
Striatin-4
STRN4
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GN16R4GN16_HUMAN
Striatin-4
STRN4
316Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R317M0R317_HUMAN
Striatin-4
STRN4
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0P4M0R0P4_HUMAN
Striatin-4
STRN4
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QYS2M0QYS2_HUMAN
Striatin-4
STRN4
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QXN2M0QXN2_HUMAN
Striatin-4
STRN4
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R2A7M0R2A7_HUMAN
Striatin-4
STRN4
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti356I → V in AAF29527 (PubMed:10748158).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053419568V → I. Corresponds to variant dbSNP:rs10409124Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0561701 – 119Missing in isoform 2. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_056171347 – 376ESRRV…GPPPG → GPELHSPTEWQGALSVGKAS PMPDWVGTAG in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_056172377 – 753Missing in isoform 2. 1 PublicationAdd BLAST377
Alternative sequenceiVSP_056738384E → EGSFGFSS in isoform 3. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF212940 mRNA Translation: AAF29527.1
AK298804 mRNA Translation: BAG60939.1
AC008622 Genomic DNA No translation available.
AC008635 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57442.1
CH471126 Genomic DNA Translation: EAW57443.1
BC004910 mRNA Translation: AAH04910.2
BC034604 mRNA Translation: AAH34604.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12690.1 [Q9NRL3-1]
CCDS42581.1 [Q9NRL3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001034966.1, NM_001039877.1 [Q9NRL3-3]
NP_037535.2, NM_013403.2 [Q9NRL3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263280; ENSP00000263280; ENSG00000090372 [Q9NRL3-1]
ENST00000391910; ENSP00000375777; ENSG00000090372 [Q9NRL3-3]
ENST00000435164; ENSP00000473607; ENSG00000090372 [Q9NRL3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29888

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29888

UCSC genome browser

More...
UCSCi
uc002pfl.4, human [Q9NRL3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF212940 mRNA Translation: AAF29527.1
AK298804 mRNA Translation: BAG60939.1
AC008622 Genomic DNA No translation available.
AC008635 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57442.1
CH471126 Genomic DNA Translation: EAW57443.1
BC004910 mRNA Translation: AAH04910.2
BC034604 mRNA Translation: AAH34604.1
CCDSiCCDS12690.1 [Q9NRL3-1]
CCDS42581.1 [Q9NRL3-3]
RefSeqiNP_001034966.1, NM_001039877.1 [Q9NRL3-3]
NP_037535.2, NM_013403.2 [Q9NRL3-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi118941, 105 interactors
IntActiQ9NRL3, 86 interactors
STRINGi9606.ENSP00000375777

PTM databases

iPTMnetiQ9NRL3
PhosphoSitePlusiQ9NRL3

Genetic variation databases

BioMutaiSTRN4
DMDMi152031693

Proteomic databases

EPDiQ9NRL3
jPOSTiQ9NRL3
MassIVEiQ9NRL3
MaxQBiQ9NRL3
PaxDbiQ9NRL3
PeptideAtlasiQ9NRL3
PRIDEiQ9NRL3
ProteomicsDBi29195
4874
82385 [Q9NRL3-1]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q9NRL3, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
49367, 174 antibodies

Genome annotation databases

EnsembliENST00000263280; ENSP00000263280; ENSG00000090372 [Q9NRL3-1]
ENST00000391910; ENSP00000375777; ENSG00000090372 [Q9NRL3-3]
ENST00000435164; ENSP00000473607; ENSG00000090372 [Q9NRL3-2]
GeneIDi29888
KEGGihsa:29888
UCSCiuc002pfl.4, human [Q9NRL3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29888
DisGeNETi29888

GeneCards: human genes, protein and diseases

More...
GeneCardsi
STRN4
HGNCiHGNC:15721, STRN4
HPAiENSG00000090372, Low tissue specificity
MIMi614767, gene
neXtProtiNX_Q9NRL3
OpenTargetsiENSG00000090372
PharmGKBiPA134863218
VEuPathDBiHostDB:ENSG00000090372.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0642, Eukaryota
GeneTreeiENSGT00950000183095
HOGENOMiCLU_009108_2_0_1
InParanoidiQ9NRL3
OMAiLQGMMSD
OrthoDBi334070at2759
PhylomeDBiQ9NRL3
TreeFamiTF313387

Enzyme and pathway databases

PathwayCommonsiQ9NRL3
SignaLinkiQ9NRL3
SIGNORiQ9NRL3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
29888, 16 hits in 995 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
STRN4, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
STRN4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29888
PharosiQ9NRL3, Tbio

Protein Ontology

More...
PROi
PR:Q9NRL3
RNActiQ9NRL3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000090372, Expressed in testis and 200 other tissues
ExpressionAtlasiQ9NRL3, baseline and differential
GenevisibleiQ9NRL3, HS

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR020472, G-protein_beta_WD-40_rep
IPR013258, Striatin_N
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR019775, WD40_repeat_CS
IPR017986, WD40_repeat_dom
IPR036322, WD40_repeat_dom_sf
PfamiView protein in Pfam
PF08232, Striatin, 1 hit
PF00400, WD40, 4 hits
PRINTSiPR00320, GPROTEINBRPT
SMARTiView protein in SMART
SM00320, WD40, 7 hits
SUPFAMiSSF50978, SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678, WD_REPEATS_1, 1 hit
PS50082, WD_REPEATS_2, 4 hits
PS50294, WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTRN4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NRL3
Secondary accession number(s): A0A024R0V2
, B4DQH7, F8VYA6, Q8NE53
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: July 10, 2007
Last modified: April 7, 2021
This is version 182 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again