Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Striatin-4

Gene

STRN4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.

Miscellaneous

The name 'Zinedin' probably originates from the name of the famous soccer player from Marseille (Zinedine Zidane).

GO - Molecular functioni

  • armadillo repeat domain binding Source: UniProtKB
  • calmodulin binding Source: GO_Central
  • protein-containing complex binding Source: UniProtKB
  • protein phosphatase 2A binding Source: UniProtKB

Keywordsi

Molecular functionCalmodulin-binding

Enzyme and pathway databases

SignaLinkiQ9NRL3

Names & Taxonomyi

Protein namesi
Recommended name:
Striatin-4
Alternative name(s):
Zinedin
Gene namesi
Name:STRN4
Synonyms:ZIN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000090372.14
HGNCiHGNC:15721 STRN4
MIMi614767 gene
neXtProtiNX_Q9NRL3

Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi29888
OpenTargetsiENSG00000090372
PharmGKBiPA134863218

Polymorphism and mutation databases

BioMutaiSTRN4
DMDMi152031693

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000512391 – 753Striatin-4Add BLAST753

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei53PhosphoserineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei276PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NRL3
MaxQBiQ9NRL3
PaxDbiQ9NRL3
PeptideAtlasiQ9NRL3
PRIDEiQ9NRL3
ProteomicsDBi82385

PTM databases

iPTMnetiQ9NRL3
PhosphoSitePlusiQ9NRL3

Miscellaneous databases

PMAP-CutDBiQ9NRL3

Expressioni

Gene expression databases

BgeeiENSG00000090372 Expressed in 188 organ(s), highest expression level in testis
CleanExiHS_STRN4
ExpressionAtlasiQ9NRL3 baseline and differential
GenevisibleiQ9NRL3 HS

Organism-specific databases

HPAiHPA043051
HPA043527
HPA056706

Interactioni

Subunit structurei

Interacts with CTTNBP2; this interaction may regulate dendritic spine distribution of STRN4. Activation of glutamate receptors weakens the interaction with CTTNBP2 (By similarity). Interacts with CTTNBP2NL.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
JUNP054123EBI-717245,EBI-852823

GO - Molecular functioni

Protein-protein interaction databases

BioGridi118941, 86 interactors
IntActiQ9NRL3, 64 interactors
STRINGi9606.ENSP00000375777

Structurei

3D structure databases

ProteinModelPortaliQ9NRL3
SMRiQ9NRL3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati436 – 475WD 1Add BLAST40
Repeati489 – 528WD 2Add BLAST40
Repeati542 – 581WD 3Add BLAST40
Repeati587 – 628WD 4Add BLAST42
Repeati635 – 674WD 5Add BLAST40
Repeati677 – 716WD 6Add BLAST40
Repeati723 – 752WD 7Add BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni71 – 79Caveolin-bindingSequence analysis9
Regioni165 – 182Calmodulin-bindingSequence analysisAdd BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili69 – 136Sequence analysisAdd BLAST68

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi6 – 14Poly-Ala9

Sequence similaritiesi

Belongs to the WD repeat striatin family.Curated

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0642 Eukaryota
ENOG410XR31 LUCA
GeneTreeiENSGT00520000055597
HOGENOMiHOG000236343
HOVERGENiHBG007117
InParanoidiQ9NRL3
KOiK17608
OMAiTWNPRFT
OrthoDBiEOG091G0509
PhylomeDBiQ9NRL3
TreeFamiTF313387

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR013258 Striatin_N
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF08232 Striatin, 1 hit
PF00400 WD40, 4 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NRL3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMEERAAAAV AAAASSCRPL GSGAGPGPTG AAPVSAPAPG PGPAGKGGGG
60 70 80 90 100
GGSPGPTAGP EPLSLPGILH FIQHEWARFE AEKARWEAER AELQAQVAFL
110 120 130 140 150
QGERKGQENL KTDLVRRIKM LEYALKQERA KYHKLKFGTD LNQGEKKADV
160 170 180 190 200
SEQVSNGPVE SVTLENSPLV WKEGRQLLRQ YLEEVGYTDT ILDMRSKRVR
210 220 230 240 250
SLLGRSLELN GAVEPSEGAP RAPPGPAGLS GGESLLVKQI EEQIKRNAAG
260 270 280 290 300
KDGKERLGGS VLGQIPFLQN CEDEDSDEDD ELDSVQHKKQ RVKLPSKALV
310 320 330 340 350
PEMEDEDEED DSEDAINEFD FLGSGEDGEG APDPRRCTVD GSPHELESRR
360 370 380 390 400
VKLQGILADL RDVDGLPPKV TGPPPGTPQP RPHEDVFIMD TIGGGEVSLG
410 420 430 440 450
DLADLTVTND NDLSCDLSDS KDAFKKTWNP KFTLRSHYDG IRSLAFHHSQ
460 470 480 490 500
SALLTASEDG TLKLWNLQKA VTAKKNAALD VEPIHAFRAH RGPVLAVAMG
510 520 530 540 550
SNSEYCYSGG ADACIHSWKI PDLSMDPYDG YDPSVLSHVL EGHGDAVWGL
560 570 580 590 600
AFSPTSQRLA SCSADGTVRI WDPSSSSPAC LCTFPTASEH GVPTSVAFTS
610 620 630 640 650
TEPAHIVASF RSGDTVLYDM EVGSALLTLE SRGSSGPTQI NQVVSHPNQP
660 670 680 690 700
LTITAHDDRG IRFLDNRTGK PVHSMVAHLD AVTCLAVDPN GAFLMSGSHD
710 720 730 740 750
CSLRLWSLDN KTCVQEITAH RKKHEEAIHA VACHPSKALI ASAGADALAK

VFV
Length:753
Mass (Da):80,596
Last modified:July 10, 2007 - v2
Checksum:i339AC24E26A9CD54
GO
Isoform 2 (identifier: Q9NRL3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-119: Missing.
     347-376: ESRRVKLQGILADLRDVDGLPPKVTGPPPG → GPELHSPTEWQGALSVGKASPMPDWVGTAG
     377-753: Missing.

Note: No experimental confirmation available.
Show »
Length:257
Mass (Da):28,106
Checksum:iA3898671C11A1A4C
GO
Isoform 3 (identifier: Q9NRL3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     384-384: E → EGSFGFSS

Show »
Length:760
Mass (Da):81,266
Checksum:i653E59DBCD215E42
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYK2F5GYK2_HUMAN
Striatin-4
STRN4
634Annotation score:
M0QZM0M0QZM0_HUMAN
Striatin-4
STRN4
317Annotation score:
M0R317M0R317_HUMAN
Striatin-4
STRN4
198Annotation score:
M0R0W8M0R0W8_HUMAN
Striatin-4
STRN4
180Annotation score:
M0R0P4M0R0P4_HUMAN
Striatin-4
STRN4
139Annotation score:
M0R2A7M0R2A7_HUMAN
Striatin-4
STRN4
103Annotation score:
R4GN16R4GN16_HUMAN
Striatin-4
STRN4
316Annotation score:
M0QYS2M0QYS2_HUMAN
Striatin-4
STRN4
114Annotation score:
M0QXN2M0QXN2_HUMAN
Striatin-4
STRN4
73Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti356I → V in AAF29527 (PubMed:10748158).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053419568V → I. Corresponds to variant dbSNP:rs10409124Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0561701 – 119Missing in isoform 2. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_056171347 – 376ESRRV…GPPPG → GPELHSPTEWQGALSVGKAS PMPDWVGTAG in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_056172377 – 753Missing in isoform 2. 1 PublicationAdd BLAST377
Alternative sequenceiVSP_056738384E → EGSFGFSS in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF212940 mRNA Translation: AAF29527.1
AK298804 mRNA Translation: BAG60939.1
AC008622 Genomic DNA No translation available.
AC008635 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57442.1
CH471126 Genomic DNA Translation: EAW57443.1
BC004910 mRNA Translation: AAH04910.2
BC034604 mRNA Translation: AAH34604.1
CCDSiCCDS12690.1 [Q9NRL3-1]
CCDS42581.1 [Q9NRL3-3]
RefSeqiNP_001034966.1, NM_001039877.1 [Q9NRL3-3]
NP_037535.2, NM_013403.2 [Q9NRL3-1]
UniGeneiHs.631590

Genome annotation databases

EnsembliENST00000263280; ENSP00000263280; ENSG00000090372 [Q9NRL3-1]
ENST00000391910; ENSP00000375777; ENSG00000090372 [Q9NRL3-3]
ENST00000435164; ENSP00000473607; ENSG00000090372 [Q9NRL3-2]
GeneIDi29888
KEGGihsa:29888
UCSCiuc002pfl.4 human [Q9NRL3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF212940 mRNA Translation: AAF29527.1
AK298804 mRNA Translation: BAG60939.1
AC008622 Genomic DNA No translation available.
AC008635 Genomic DNA No translation available.
CH471126 Genomic DNA Translation: EAW57442.1
CH471126 Genomic DNA Translation: EAW57443.1
BC004910 mRNA Translation: AAH04910.2
BC034604 mRNA Translation: AAH34604.1
CCDSiCCDS12690.1 [Q9NRL3-1]
CCDS42581.1 [Q9NRL3-3]
RefSeqiNP_001034966.1, NM_001039877.1 [Q9NRL3-3]
NP_037535.2, NM_013403.2 [Q9NRL3-1]
UniGeneiHs.631590

3D structure databases

ProteinModelPortaliQ9NRL3
SMRiQ9NRL3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118941, 86 interactors
IntActiQ9NRL3, 64 interactors
STRINGi9606.ENSP00000375777

PTM databases

iPTMnetiQ9NRL3
PhosphoSitePlusiQ9NRL3

Polymorphism and mutation databases

BioMutaiSTRN4
DMDMi152031693

Proteomic databases

EPDiQ9NRL3
MaxQBiQ9NRL3
PaxDbiQ9NRL3
PeptideAtlasiQ9NRL3
PRIDEiQ9NRL3
ProteomicsDBi82385

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263280; ENSP00000263280; ENSG00000090372 [Q9NRL3-1]
ENST00000391910; ENSP00000375777; ENSG00000090372 [Q9NRL3-3]
ENST00000435164; ENSP00000473607; ENSG00000090372 [Q9NRL3-2]
GeneIDi29888
KEGGihsa:29888
UCSCiuc002pfl.4 human [Q9NRL3-1]

Organism-specific databases

CTDi29888
DisGeNETi29888
EuPathDBiHostDB:ENSG00000090372.14
GeneCardsiSTRN4
H-InvDBiHIX0096898
HGNCiHGNC:15721 STRN4
HPAiHPA043051
HPA043527
HPA056706
MIMi614767 gene
neXtProtiNX_Q9NRL3
OpenTargetsiENSG00000090372
PharmGKBiPA134863218
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0642 Eukaryota
ENOG410XR31 LUCA
GeneTreeiENSGT00520000055597
HOGENOMiHOG000236343
HOVERGENiHBG007117
InParanoidiQ9NRL3
KOiK17608
OMAiTWNPRFT
OrthoDBiEOG091G0509
PhylomeDBiQ9NRL3
TreeFamiTF313387

Enzyme and pathway databases

SignaLinkiQ9NRL3

Miscellaneous databases

ChiTaRSiSTRN4 human
GeneWikiiSTRN4
GenomeRNAii29888
PMAP-CutDBiQ9NRL3
PROiPR:Q9NRL3
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000090372 Expressed in 188 organ(s), highest expression level in testis
CleanExiHS_STRN4
ExpressionAtlasiQ9NRL3 baseline and differential
GenevisibleiQ9NRL3 HS

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR013258 Striatin_N
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF08232 Striatin, 1 hit
PF00400 WD40, 4 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 4 hits
PS50294 WD_REPEATS_REGION, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSTRN4_HUMAN
AccessioniPrimary (citable) accession number: Q9NRL3
Secondary accession number(s): A0A024R0V2
, B4DQH7, F8VYA6, Q8NE53
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: July 10, 2007
Last modified: November 7, 2018
This is version 164 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again