Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Suppressor of tumorigenicity 7 protein

Gene

ST7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May act as a tumor suppressor.1 Publication

GO - Biological processi

  • extracellular matrix organization Source: BHF-UCL
  • regulation of cell differentiation Source: BHF-UCL

Names & Taxonomyi

Protein namesi
Recommended name:
Suppressor of tumorigenicity 7 protein
Alternative name(s):
Protein FAM4A1
Protein HELG
Gene namesi
Name:ST7
Synonyms:FAM4A1, HELG, RAY1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000004866.18
HGNCiHGNC:11351 ST7
MIMi600833 gene
neXtProtiNX_Q9NRC1

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei15 – 35HelicalSequence analysisAdd BLAST21
Transmembranei62 – 82HelicalSequence analysisAdd BLAST21
Transmembranei512 – 532HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi7982
OpenTargetsiENSG00000004866
PharmGKBiPA36173

Polymorphism and mutation databases

BioMutaiST7
DMDMi74734319

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003392021 – 585Suppressor of tumorigenicity 7 proteinAdd BLAST585

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei386PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9NRC1
PaxDbiQ9NRC1
PeptideAtlasiQ9NRC1
PRIDEiQ9NRC1
ProteomicsDBi82326
82327 [Q9NRC1-2]
82328 [Q9NRC1-3]
82329 [Q9NRC1-4]
82330 [Q9NRC1-5]
82331 [Q9NRC1-6]
82332 [Q9NRC1-7]
TopDownProteomicsiQ9NRC1-1 [Q9NRC1-1]

PTM databases

iPTMnetiQ9NRC1
PhosphoSitePlusiQ9NRC1

Expressioni

Tissue specificityi

Ubiquitously expressed, with highest levels in heart, liver and pancreas.2 Publications

Gene expression databases

BgeeiENSG00000004866 Expressed in 216 organ(s), highest expression level in popliteal artery
CleanExiHS_ST7
ExpressionAtlasiQ9NRC1 baseline and differential
GenevisibleiQ9NRC1 HS

Organism-specific databases

HPAiHPA038325
HPA038326

Interactioni

Protein-protein interaction databases

BioGridi113695, 40 interactors
IntActiQ9NRC1, 3 interactors
STRINGi9606.ENSP00000265437

Structurei

3D structure databases

ProteinModelPortaliQ9NRC1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ST7 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3807 Eukaryota
ENOG410XQ2Z LUCA
GeneTreeiENSGT00390000000873
HOVERGENiHBG054916
InParanoidiQ9NRC1
OMAiPIMNVLN
OrthoDBiEOG091G05WJ
PhylomeDBiQ9NRC1
TreeFamiTF314162

Family and domain databases

CDDicd11557 ST7, 1 hit
Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR007311 ST7
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR12745 PTHR12745, 1 hit
PfamiView protein in Pfam
PF04184 ST7, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 18 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NRC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEAATGFLE QLKSCIVWSW TYLWTVWFFI VLFLVYILRV PLKINDNLST
60 70 80 90 100
VSMFLNTLTP KFYVALTGTS SLISGLILIF EWWYFRKYGT SFIEQVSVSH
110 120 130 140 150
LRPLLGGVDN NSSNNSNSSN GDSDSNRQSV SECKVWRNPL NLFRGAEYNR
160 170 180 190 200
YTWVTGREPL TYYDMNLSAQ DHQTFFTCDS DHLRPADAIM QKAWRERNPQ
210 220 230 240 250
ARISAAHEAL EINEIRSRVE VPLIASSTIW EIKLLPKCAT AYILLAEEEA
260 270 280 290 300
TTIAEAEKLF KQALKAGDGC YRRSQQLQHH GSQYEAQHRR DTNVLVYIKR
310 320 330 340 350
RLAMCARRLG RTREAVKMMR DLMKEFPLLS MFNIHENLLE ALLELQAYAD
360 370 380 390 400
VQAVLAKYDD ISLPKSATIC YTAALLKARA VSDKFSPEAA SRRGLSTAEM
410 420 430 440 450
NAVEAIHRAV EFNPHVPKYL LEMKSLILPP EHILKRGDSE AIAYAFFHLA
460 470 480 490 500
HWKRVEGALN LLHCTWEGTF RMIPYPLEKG HLFYPYPICT ETADRELLPS
510 520 530 540 550
FHEVSVYPKK ELPFFILFTA GLCSFTAMLA LLTHQFPELM GVFAKAMIDI
560 570 580
FCSAEFRDWN CKSIFMRVED ELEIPPAPQS QHFQN
Length:585
Mass (Da):67,166
Last modified:October 1, 2000 - v1
Checksum:i7BA8974E564B307F
GO
Isoform 2 (identifier: Q9NRC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-237: Missing.
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:554
Mass (Da):63,480
Checksum:i50DB3810D668D33D
GO
Isoform 3 (identifier: Q9NRC1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     116-122: Missing.
     215-237: Missing.
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:547
Mass (Da):62,819
Checksum:iB5F12BD1BE99BC56
GO
Isoform 4 (identifier: Q9NRC1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-50: WFFIVLFLVYILRVPLKINDNLST → MFGTESS
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:534
Mass (Da):60,928
Checksum:i96CEB7C19A6CAD81
GO
Isoform 5 (identifier: Q9NRC1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-50: WFFIVLFLVYILRVPLKINDNLST → MFGTESS
     215-237: Missing.
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:511
Mass (Da):58,297
Checksum:i8517998EB2148278
GO
Isoform 6 (identifier: Q9NRC1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     51-51: V → M
     215-237: Missing.
     464-469: CTWEGT → S
     547-585: MIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN → FLSTLFAPLNFVMEKVESILPSSLWHQLTRI

Show »
Length:499
Mass (Da):56,999
Checksum:i3C86C8A734825025
GO
Isoform 7 (identifier: Q9NRC1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     215-237: Missing.
     419-422: YLLE → ARWK
     423-585: Missing.

Show »
Length:399
Mass (Da):45,665
Checksum:iE1B51714BFAE56FD
GO

Computationally mapped potential isoform sequencesi

There are 18 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z4L1B7Z4L1_HUMAN
Suppression of tumorigenicity 7, is...
ST7 hCG_15955
534Annotation score:
C9JU30C9JU30_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
561Annotation score:
B7Z4U3B7Z4U3_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
531Annotation score:
E7EPD9E7EPD9_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
572Annotation score:
H7BXS2H7BXS2_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
577Annotation score:
C9JRQ0C9JRQ0_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
138Annotation score:
E7ENZ9E7ENZ9_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
558Annotation score:
C9JRW1C9JRW1_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
251Annotation score:
E7EPW5E7EPW5_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
508Annotation score:
E9PCV1E9PCV1_HUMAN
Suppressor of tumorigenicity 7 prot...
ST7
523Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence CAB86869 differs from that shown. Reason: Erroneous initiation.Curated
The sequence EAW83520 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043932186A → T1 PublicationCorresponds to variant dbSNP:rs201219065Ensembl.1
Natural variantiVAR_043933361I → V1 PublicationCorresponds to variant dbSNP:rs1362000016Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0341081 – 50Missing in isoform 6. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0341091 – 26Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_03411027 – 50WFFIV…DNLST → MFGTESS in isoform 4 and isoform 5. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_03411151V → M in isoform 6. 1 Publication1
Alternative sequenceiVSP_034112116 – 122Missing in isoform 3. 1 Publication7
Alternative sequenceiVSP_034113215 – 237Missing in isoform 2, isoform 3, isoform 5, isoform 6 and isoform 7. 7 PublicationsAdd BLAST23
Alternative sequenceiVSP_034114419 – 422YLLE → ARWK in isoform 7. 1 Publication4
Alternative sequenceiVSP_034115423 – 585Missing in isoform 7. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_034116464 – 469CTWEGT → S in isoform 6. 1 Publication6
Alternative sequenceiVSP_034117547 – 585MIDIF…QHFQN → FLSTLFAPLNFVMEKVESIL PSSLWHQLTRI in isoform 2, isoform 3, isoform 4, isoform 5 and isoform 6. 6 PublicationsAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234882 mRNA Translation: AAF85945.1
AF234883 mRNA Translation: AAF85946.1
AY009152 mRNA Translation: AAG37720.1
AY009153 mRNA Translation: AAG37721.1
AK093212 mRNA Translation: BAC04097.1
CH236947 Genomic DNA Translation: EAL24356.1
CH236947 Genomic DNA Translation: EAL24357.1
AC002542 Genomic DNA Translation: AAS07414.1
AC002542 Genomic DNA Translation: AAS07415.1
CH471070 Genomic DNA Translation: EAW83520.1 Sequence problems.
BC030954 mRNA Translation: AAH30954.1
BC075855 mRNA Translation: AAH75855.1
AF415174 mRNA Translation: AAL85662.1
CR936656 mRNA Translation: CAI56794.1
AJ277291 mRNA Translation: CAB86869.1 Different initiation.
CCDSiCCDS5769.1 [Q9NRC1-2]
CCDS5770.1 [Q9NRC1-1]
PIRiT50625
RefSeqiNP_060882.2, NM_018412.3 [Q9NRC1-2]
NP_068708.1, NM_021908.2 [Q9NRC1-1]
UniGeneiHs.368131

Genome annotation databases

EnsembliENST00000265437; ENSP00000265437; ENSG00000004866 [Q9NRC1-1]
ENST00000393443; ENSP00000377089; ENSG00000004866 [Q9NRC1-6]
ENST00000393451; ENSP00000377097; ENSG00000004866 [Q9NRC1-2]
GeneIDi7982
KEGGihsa:7982
UCSCiuc003vio.4 human [Q9NRC1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF234882 mRNA Translation: AAF85945.1
AF234883 mRNA Translation: AAF85946.1
AY009152 mRNA Translation: AAG37720.1
AY009153 mRNA Translation: AAG37721.1
AK093212 mRNA Translation: BAC04097.1
CH236947 Genomic DNA Translation: EAL24356.1
CH236947 Genomic DNA Translation: EAL24357.1
AC002542 Genomic DNA Translation: AAS07414.1
AC002542 Genomic DNA Translation: AAS07415.1
CH471070 Genomic DNA Translation: EAW83520.1 Sequence problems.
BC030954 mRNA Translation: AAH30954.1
BC075855 mRNA Translation: AAH75855.1
AF415174 mRNA Translation: AAL85662.1
CR936656 mRNA Translation: CAI56794.1
AJ277291 mRNA Translation: CAB86869.1 Different initiation.
CCDSiCCDS5769.1 [Q9NRC1-2]
CCDS5770.1 [Q9NRC1-1]
PIRiT50625
RefSeqiNP_060882.2, NM_018412.3 [Q9NRC1-2]
NP_068708.1, NM_021908.2 [Q9NRC1-1]
UniGeneiHs.368131

3D structure databases

ProteinModelPortaliQ9NRC1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113695, 40 interactors
IntActiQ9NRC1, 3 interactors
STRINGi9606.ENSP00000265437

PTM databases

iPTMnetiQ9NRC1
PhosphoSitePlusiQ9NRC1

Polymorphism and mutation databases

BioMutaiST7
DMDMi74734319

Proteomic databases

EPDiQ9NRC1
PaxDbiQ9NRC1
PeptideAtlasiQ9NRC1
PRIDEiQ9NRC1
ProteomicsDBi82326
82327 [Q9NRC1-2]
82328 [Q9NRC1-3]
82329 [Q9NRC1-4]
82330 [Q9NRC1-5]
82331 [Q9NRC1-6]
82332 [Q9NRC1-7]
TopDownProteomicsiQ9NRC1-1 [Q9NRC1-1]

Protocols and materials databases

DNASUi7982
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265437; ENSP00000265437; ENSG00000004866 [Q9NRC1-1]
ENST00000393443; ENSP00000377089; ENSG00000004866 [Q9NRC1-6]
ENST00000393451; ENSP00000377097; ENSG00000004866 [Q9NRC1-2]
GeneIDi7982
KEGGihsa:7982
UCSCiuc003vio.4 human [Q9NRC1-1]

Organism-specific databases

CTDi7982
DisGeNETi7982
EuPathDBiHostDB:ENSG00000004866.18
GeneCardsiST7
ST7-OT3
H-InvDBiHIX0033793
HGNCiHGNC:11351 ST7
HPAiHPA038325
HPA038326
MIMi600833 gene
neXtProtiNX_Q9NRC1
OpenTargetsiENSG00000004866
PharmGKBiPA36173
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3807 Eukaryota
ENOG410XQ2Z LUCA
GeneTreeiENSGT00390000000873
HOVERGENiHBG054916
InParanoidiQ9NRC1
OMAiPIMNVLN
OrthoDBiEOG091G05WJ
PhylomeDBiQ9NRC1
TreeFamiTF314162

Miscellaneous databases

ChiTaRSiST7 human
GeneWikiiST7
GenomeRNAii7982
PROiPR:Q9NRC1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000004866 Expressed in 216 organ(s), highest expression level in popliteal artery
CleanExiHS_ST7
ExpressionAtlasiQ9NRC1 baseline and differential
GenevisibleiQ9NRC1 HS

Family and domain databases

CDDicd11557 ST7, 1 hit
Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR007311 ST7
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR12745 PTHR12745, 1 hit
PfamiView protein in Pfam
PF04184 ST7, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiST7_HUMAN
AccessioniPrimary (citable) accession number: Q9NRC1
Secondary accession number(s): A4D0V2
, Q5CZ72, Q7LE31, Q7LE32, Q8NA32, Q8NEJ8, Q8TDI9, Q9BWX3, Q9BWX4, Q9NRC2, Q9NXZ7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: October 1, 2000
Last modified: November 7, 2018
This is version 140 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again