Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 3

Gene

ARHGEF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 3
Alternative name(s):
Exchange factor found in platelets and leukemic and neuronal tissues
Short name:
XPLN
Gene namesi
Name:ARHGEF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000163947.11
HGNCiHGNC:683 ARHGEF3
MIMi612115 gene
neXtProtiNX_Q9NR81

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi50650
OpenTargetsiENSG00000163947
PharmGKBiPA24973

Polymorphism and mutation databases

BioMutaiARHGEF3
DMDMi52782760

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000809111 – 526Rho guanine nucleotide exchange factor 3Add BLAST526

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei47PhosphoserineCombined sources1
Modified residuei70PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NR81
MaxQBiQ9NR81
PaxDbiQ9NR81
PeptideAtlasiQ9NR81
PRIDEiQ9NR81
ProteomicsDBi82296
82297 [Q9NR81-2]
82298 [Q9NR81-3]
82299 [Q9NR81-4]

PTM databases

iPTMnetiQ9NR81
PhosphoSitePlusiQ9NR81

Expressioni

Tissue specificityi

Widely expressed. Highest levels are found in adult brain and skeletal muscle. Lower levels are found in heart and kidney.2 Publications

Gene expression databases

BgeeiENSG00000163947 Expressed in 221 organ(s), highest expression level in metanephric glomerulus
CleanExiHS_ARHGEF3
ExpressionAtlasiQ9NR81 baseline and differential
GenevisibleiQ9NR81 HS

Organism-specific databases

HPAiHPA034715
HPA064945

Interactioni

Subunit structurei

Interacts with RHOA and RHOB.

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119115, 9 interactors
IntActiQ9NR81, 9 interactors
STRINGi9606.ENSP00000341071

Structurei

3D structure databases

ProteinModelPortaliQ9NR81
SMRiQ9NR81
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini122 – 304DHPROSITE-ProRule annotationAdd BLAST183
Domaini291 – 449PHPROSITE-ProRule annotationAdd BLAST159

Phylogenomic databases

eggNOGiKOG4305 Eukaryota
COG5422 LUCA
GeneTreeiENSGT00760000119193
HOVERGENiHBG050567
InParanoidiQ9NR81
KOiK20683
OMAiGWLPCLS
OrthoDBiEOG091G05S7
PhylomeDBiQ9NR81
TreeFamiTF328974

Family and domain databases

CDDicd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PfamiView protein in Pfam
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
PROSITEiView protein in PROSITE
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q9NR81-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVAKDYPFYL TVKRANCSLE LPPASGPAKD AEEPSNKRVK PLSRVTSLAN
60 70 80 90 100
LIPPVKATPL KRFSQTLQRS ISFRSESRPD ILAPRPWSRN AAPSSTKRRD
110 120 130 140 150
SKLWSETFDV CVNQMLTSKE IKRQEAIFEL SQGEEDLIED LKLAKKAYHD
160 170 180 190 200
PMLKLSIMTE QELNQIFGTL DSLIPLHEEL LSQLRDVRKP DGSTEHVGPI
210 220 230 240 250
LVGWLPCLSS YDSYCSNQVA AKALLDHKKQ DHRVQDFLQR CLESPFSRKL
260 270 280 290 300
DLWNFLDIPR SRLVKYPLLL REILRHTPND NPDQQHLEEA INIIQGIVAE
310 320 330 340 350
INTKTGESEC RYYKERLLYL EEGQKDSLID SSRVLCCHGE LKNNRGVKLH
360 370 380 390 400
VFLFQEVLVI TRAVTHNEQL CYQLYRQPIP VKDLLLEDLQ DGEVRLGGSL
410 420 430 440 450
RGAFSNNERI KNFFRVSFKN GSQSQTHSLQ ANDTFNKQQW LNCIRQAKET
460 470 480 490 500
VLCAAGQAGV LDSEGSFLNP TTGSRELQGE TKLEQMDQSD SESDCSMDTS
510 520
EVSLDCERME QTDSSCGNSR HGESNV
Length:526
Mass (Da):59,783
Last modified:October 1, 2000 - v1
Checksum:i0FE8248AB52D1CBC
GO
Isoform 2 (identifier: Q9NR81-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MDSSTAMNQC...AVSLCSLDIS

Note: No experimental confirmation available.
Show »
Length:558
Mass (Da):63,755
Checksum:iC01C434F0858A58C
GO
Isoform 3 (identifier: Q9NR81-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MIEVCHHNWLLWLCPSKFGIFMCCLASTTGQMELRRTR

Note: No experimental confirmation available.
Show »
Length:532
Mass (Da):60,813
Checksum:i64940517719915C0
GO
Isoform 4 (identifier: Q9NR81-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-202: Missing.
     203-204: GW → MK

Note: No experimental confirmation available.
Show »
Length:324
Mass (Da):36,981
Checksum:iDF90022C9392296E
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PG37E9PG37_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
532Annotation score:
C9J586C9J586_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
416Annotation score:
E7EU49E7EU49_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
497Annotation score:
H7C4P0H7C4P0_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
236Annotation score:
C9J609C9J609_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
184Annotation score:
C9JNF2C9JNF2_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
196Annotation score:
C9J5K8C9J5K8_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
100Annotation score:
F8WC29F8WC29_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
50Annotation score:
F8WDB7F8WDB7_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
70Annotation score:

Sequence cautioni

The sequence AAH68513 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14891 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD92898 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti410I → T in AAP97313 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02193513K → R. Corresponds to variant dbSNP:rs3732507Ensembl.1
Natural variantiVAR_021936335L → V4 PublicationsCorresponds to variant dbSNP:rs3772219Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0272041 – 202Missing in isoform 4. 1 PublicationAdd BLAST202
Alternative sequenceiVSP_0116121 – 32MVAKD…AKDAE → MDSSTAMNQCSCRGMEENKE RPKRQRQNNFPMFPSPKAWN FRGRKRKQSTQDEDAVSLCS LDIS in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0272051 – 32MVAKD…AKDAE → MIEVCHHNWLLWLCPSKFGI FMCCLASTTGQMELRRTR in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027206203 – 204GW → MK in isoform 4. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF249744 mRNA Translation: AAF79954.1
AL136832 mRNA Translation: CAB66766.1
AF433662 mRNA Translation: AAP97313.1
AK024340 mRNA Translation: BAB14891.1 Different initiation.
AK291412 mRNA Translation: BAF84101.1
AB209661 mRNA Translation: BAD92898.1 Different initiation.
CH471055 Genomic DNA Translation: EAW65326.1
BC054345 mRNA Translation: AAH54345.2
BC068513 mRNA Translation: AAH68513.1 Different initiation.
BC098122 mRNA Translation: AAH98122.2
BC098272 mRNA Translation: AAH98272.2
BC099715 mRNA Translation: AAH99715.1
BC104723 mRNA Translation: AAI04724.2
CCDSiCCDS2878.1 [Q9NR81-1]
CCDS46854.1 [Q9NR81-2]
CCDS46855.1 [Q9NR81-3]
RefSeqiNP_001122087.1, NM_001128615.1 [Q9NR81-2]
NP_001122088.1, NM_001128616.1 [Q9NR81-3]
NP_001276627.1, NM_001289698.1
NP_062455.1, NM_019555.2 [Q9NR81-1]
XP_005265243.1, XM_005265186.4 [Q9NR81-2]
XP_005265244.1, XM_005265187.3 [Q9NR81-2]
UniGeneiHs.476402

Genome annotation databases

EnsembliENST00000296315; ENSP00000296315; ENSG00000163947 [Q9NR81-1]
ENST00000338458; ENSP00000341071; ENSG00000163947 [Q9NR81-2]
ENST00000413728; ENSP00000410922; ENSG00000163947 [Q9NR81-3]
GeneIDi50650
KEGGihsa:50650
UCSCiuc003dif.3 human [Q9NR81-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF249744 mRNA Translation: AAF79954.1
AL136832 mRNA Translation: CAB66766.1
AF433662 mRNA Translation: AAP97313.1
AK024340 mRNA Translation: BAB14891.1 Different initiation.
AK291412 mRNA Translation: BAF84101.1
AB209661 mRNA Translation: BAD92898.1 Different initiation.
CH471055 Genomic DNA Translation: EAW65326.1
BC054345 mRNA Translation: AAH54345.2
BC068513 mRNA Translation: AAH68513.1 Different initiation.
BC098122 mRNA Translation: AAH98122.2
BC098272 mRNA Translation: AAH98272.2
BC099715 mRNA Translation: AAH99715.1
BC104723 mRNA Translation: AAI04724.2
CCDSiCCDS2878.1 [Q9NR81-1]
CCDS46854.1 [Q9NR81-2]
CCDS46855.1 [Q9NR81-3]
RefSeqiNP_001122087.1, NM_001128615.1 [Q9NR81-2]
NP_001122088.1, NM_001128616.1 [Q9NR81-3]
NP_001276627.1, NM_001289698.1
NP_062455.1, NM_019555.2 [Q9NR81-1]
XP_005265243.1, XM_005265186.4 [Q9NR81-2]
XP_005265244.1, XM_005265187.3 [Q9NR81-2]
UniGeneiHs.476402

3D structure databases

ProteinModelPortaliQ9NR81
SMRiQ9NR81
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119115, 9 interactors
IntActiQ9NR81, 9 interactors
STRINGi9606.ENSP00000341071

PTM databases

iPTMnetiQ9NR81
PhosphoSitePlusiQ9NR81

Polymorphism and mutation databases

BioMutaiARHGEF3
DMDMi52782760

Proteomic databases

EPDiQ9NR81
MaxQBiQ9NR81
PaxDbiQ9NR81
PeptideAtlasiQ9NR81
PRIDEiQ9NR81
ProteomicsDBi82296
82297 [Q9NR81-2]
82298 [Q9NR81-3]
82299 [Q9NR81-4]

Protocols and materials databases

DNASUi50650
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296315; ENSP00000296315; ENSG00000163947 [Q9NR81-1]
ENST00000338458; ENSP00000341071; ENSG00000163947 [Q9NR81-2]
ENST00000413728; ENSP00000410922; ENSG00000163947 [Q9NR81-3]
GeneIDi50650
KEGGihsa:50650
UCSCiuc003dif.3 human [Q9NR81-1]

Organism-specific databases

CTDi50650
DisGeNETi50650
EuPathDBiHostDB:ENSG00000163947.11
GeneCardsiARHGEF3
HGNCiHGNC:683 ARHGEF3
HPAiHPA034715
HPA064945
MIMi612115 gene
neXtProtiNX_Q9NR81
OpenTargetsiENSG00000163947
PharmGKBiPA24973
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4305 Eukaryota
COG5422 LUCA
GeneTreeiENSGT00760000119193
HOVERGENiHBG050567
InParanoidiQ9NR81
KOiK20683
OMAiGWLPCLS
OrthoDBiEOG091G05S7
PhylomeDBiQ9NR81
TreeFamiTF328974

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Miscellaneous databases

ChiTaRSiARHGEF3 human
GeneWikiiARHGEF3
GenomeRNAii50650
PROiPR:Q9NR81
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163947 Expressed in 221 organ(s), highest expression level in metanephric glomerulus
CleanExiHS_ARHGEF3
ExpressionAtlasiQ9NR81 baseline and differential
GenevisibleiQ9NR81 HS

Family and domain databases

CDDicd00160 RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
IPR001331 GDS_CDC24_CS
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PfamiView protein in Pfam
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
PROSITEiView protein in PROSITE
PS00741 DH_1, 1 hit
PS50010 DH_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiARHG3_HUMAN
AccessioniPrimary (citable) accession number: Q9NR81
Secondary accession number(s): A8K5U7
, Q4FZB6, Q4QQI5, Q4QQQ0, Q59F00, Q6NUN3, Q7Z4U2, Q7Z5T2, Q9H7T4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: October 1, 2000
Last modified: September 12, 2018
This is version 152 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again