Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NR81 (ARHG3_HUMAN)

Entry version 168 (10 Feb 2021)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Rho guanine nucleotide exchange factor 3

Gene

ARHGEF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9NR81

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-193648, NRAGE signals death through JNK
R-HSA-194840, Rho GTPase cycle
R-HSA-416482, G alpha (12/13) signalling events

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9NR81

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 3
Alternative name(s):
Exchange factor found in platelets and leukemic and neuronal tissues
Short name:
XPLN
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARHGEF3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:683, ARHGEF3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		612115, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NR81

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000163947.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		50650

Open Targets

More...OpenTargetsi		ENSG00000163947

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24973

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NR81, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ARHGEF3

Domain mapping of disease mutations (DMDM)

More...DMDMi		52782760

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000809111 – 526Rho guanine nucleotide exchange factor 3Add BLAST526

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei47PhosphoserineCombined sources1
Modified residuei70PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NR81

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NR81

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NR81

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9NR81

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NR81

PeptideAtlas

More...PeptideAtlasi		Q9NR81

PRoteomics IDEntifications database

More...PRIDEi		Q9NR81

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		82296 [Q9NR81-1]
82297 [Q9NR81-2]
82298 [Q9NR81-3]
82299 [Q9NR81-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NR81

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NR81

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highest levels are found in adult brain and skeletal muscle. Lower levels are found in heart and kidney.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000163947, Expressed in metanephric glomerulus and 235 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NR81, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NR81, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000163947, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RHOA and RHOB.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		119115, 14 interactors

Protein interaction database and analysis system

More...IntActi		Q9NR81, 11 interactors

Molecular INTeraction database

More...MINTi		Q9NR81

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000341071

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NR81, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NR81

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini122 – 304DHPROSITE-ProRule annotationAdd BLAST183
Domaini291 – 449PHPROSITE-ProRule annotationAdd BLAST159

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4305, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158385

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NR81

Identification of Orthologs from Complete Genome Data

More...OMAi		PIPMKDL

Database of Orthologous Groups

More...OrthoDBi		849206at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NR81

TreeFam database of animal gene trees

More...TreeFami		TF328974

Family and domain databases

Conserved Domains Database

More...CDDi		cd10572, PH_RhoGEF3_XPLN, 1 hit
cd00160, RhoGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.900.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR001331, GDS_CDC24_CS
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR044129, PH_RhoGEF3_XPLN

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00621, RhoGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00233, PH, 1 hit
SM00325, RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48065, SSF48065, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00741, DH_1, 1 hit
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NR81-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVAKDYPFYL TVKRANCSLE LPPASGPAKD AEEPSNKRVK PLSRVTSLAN 
        60         70         80         90        100
LIPPVKATPL KRFSQTLQRS ISFRSESRPD ILAPRPWSRN AAPSSTKRRD 
       110        120        130        140        150
SKLWSETFDV CVNQMLTSKE IKRQEAIFEL SQGEEDLIED LKLAKKAYHD 
       160        170        180        190        200
PMLKLSIMTE QELNQIFGTL DSLIPLHEEL LSQLRDVRKP DGSTEHVGPI 
       210        220        230        240        250
LVGWLPCLSS YDSYCSNQVA AKALLDHKKQ DHRVQDFLQR CLESPFSRKL 
       260        270        280        290        300
DLWNFLDIPR SRLVKYPLLL REILRHTPND NPDQQHLEEA INIIQGIVAE 
       310        320        330        340        350
INTKTGESEC RYYKERLLYL EEGQKDSLID SSRVLCCHGE LKNNRGVKLH 
       360        370        380        390        400
VFLFQEVLVI TRAVTHNEQL CYQLYRQPIP VKDLLLEDLQ DGEVRLGGSL 
       410        420        430        440        450
RGAFSNNERI KNFFRVSFKN GSQSQTHSLQ ANDTFNKQQW LNCIRQAKET 
       460        470        480        490        500
VLCAAGQAGV LDSEGSFLNP TTGSRELQGE TKLEQMDQSD SESDCSMDTS 
       510        520 
EVSLDCERME QTDSSCGNSR HGESNV
Length:526
Mass (Da):59,783
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0FE8248AB52D1CBC
GO
Isoform 2 (identifier: Q9NR81-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MDSSTAMNQC...AVSLCSLDIS

Show »
Length:558
Mass (Da):63,755
Checksum:iC01C434F0858A58C
GO
Isoform 3 (identifier: Q9NR81-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MVAKDYPFYLTVKRANCSLELPPASGPAKDAE → MIEVCHHNWLLWLCPSKFGIFMCCLASTTGQMELRRTR

Show »
Length:532
Mass (Da):60,813
Checksum:i64940517719915C0
GO
Isoform 4 (identifier: Q9NR81-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-202: Missing.
     203-204: GW → MK

Show »
Length:324
Mass (Da):36,981
Checksum:iDF90022C9392296E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PG37E9PG37_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
532Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EU49E7EU49_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
497Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J586C9J586_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
416Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J609C9J609_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JNF2C9JNF2_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4P0H7C4P0_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
236Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J5K8C9J5K8_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WC29F8WC29_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDB7F8WDB7_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF3
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH68513 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14891 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD92898 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti410I → T in AAP97313 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02193513K → R. Corresponds to variant dbSNP:rs3732507Ensembl.1
Natural variantiVAR_021936335L → V4 PublicationsCorresponds to variant dbSNP:rs3772219Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0272041 – 202Missing in isoform 4. 1 PublicationAdd BLAST202
Alternative sequenceiVSP_0116121 – 32MVAKD…AKDAE → MDSSTAMNQCSCRGMEENKE RPKRQRQNNFPMFPSPKAWN FRGRKRKQSTQDEDAVSLCS LDIS in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0272051 – 32MVAKD…AKDAE → MIEVCHHNWLLWLCPSKFGI FMCCLASTTGQMELRRTR in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027206203 – 204GW → MK in isoform 4. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF249744 mRNA Translation: AAF79954.1
AL136832 mRNA Translation: CAB66766.1
AF433662 mRNA Translation: AAP97313.1
AK024340 mRNA Translation: BAB14891.1 Different initiation.
AK291412 mRNA Translation: BAF84101.1
AB209661 mRNA Translation: BAD92898.1 Different initiation.
CH471055 Genomic DNA Translation: EAW65326.1
BC054345 mRNA Translation: AAH54345.2
BC068513 mRNA Translation: AAH68513.1 Different initiation.
BC098122 mRNA Translation: AAH98122.2
BC098272 mRNA Translation: AAH98272.2
BC099715 mRNA Translation: AAH99715.1
BC104723 mRNA Translation: AAI04724.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2878.1 [Q9NR81-1]
CCDS46854.1 [Q9NR81-2]
CCDS46855.1 [Q9NR81-3]

NCBI Reference Sequences

More...RefSeqi		NP_001122087.1, NM_001128615.1 [Q9NR81-2]
NP_001122088.1, NM_001128616.1 [Q9NR81-3]
NP_001276627.1, NM_001289698.1
NP_062455.1, NM_019555.2 [Q9NR81-1]
XP_005265243.1, XM_005265186.4 [Q9NR81-2]
XP_005265244.1, XM_005265187.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000296315; ENSP00000296315; ENSG00000163947 [Q9NR81-1]
ENST00000338458; ENSP00000341071; ENSG00000163947 [Q9NR81-2]
ENST00000413728; ENSP00000410922; ENSG00000163947 [Q9NR81-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		50650

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:50650

UCSC genome browser

More...UCSCi		uc003dif.3, human [Q9NR81-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF249744 mRNA Translation: AAF79954.1
AL136832 mRNA Translation: CAB66766.1
AF433662 mRNA Translation: AAP97313.1
AK024340 mRNA Translation: BAB14891.1 Different initiation.
AK291412 mRNA Translation: BAF84101.1
AB209661 mRNA Translation: BAD92898.1 Different initiation.
CH471055 Genomic DNA Translation: EAW65326.1
BC054345 mRNA Translation: AAH54345.2
BC068513 mRNA Translation: AAH68513.1 Different initiation.
BC098122 mRNA Translation: AAH98122.2
BC098272 mRNA Translation: AAH98272.2
BC099715 mRNA Translation: AAH99715.1
BC104723 mRNA Translation: AAI04724.2
CCDSiCCDS2878.1 [Q9NR81-1]
CCDS46854.1 [Q9NR81-2]
CCDS46855.1 [Q9NR81-3]
RefSeqiNP_001122087.1, NM_001128615.1 [Q9NR81-2]
NP_001122088.1, NM_001128616.1 [Q9NR81-3]
NP_001276627.1, NM_001289698.1
NP_062455.1, NM_019555.2 [Q9NR81-1]
XP_005265243.1, XM_005265186.4 [Q9NR81-2]
XP_005265244.1, XM_005265187.3

3D structure databases

SMRiQ9NR81
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi119115, 14 interactors
IntActiQ9NR81, 11 interactors
MINTiQ9NR81
STRINGi9606.ENSP00000341071

PTM databases

iPTMnetiQ9NR81
PhosphoSitePlusiQ9NR81

Genetic variation databases

BioMutaiARHGEF3
DMDMi52782760

Proteomic databases

EPDiQ9NR81
jPOSTiQ9NR81
MassIVEiQ9NR81
MaxQBiQ9NR81
PaxDbiQ9NR81
PeptideAtlasiQ9NR81
PRIDEiQ9NR81
ProteomicsDBi82296 [Q9NR81-1]
82297 [Q9NR81-2]
82298 [Q9NR81-3]
82299 [Q9NR81-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31503, 173 antibodies

The DNASU plasmid repository

More...DNASUi		50650

Genome annotation databases

EnsembliENST00000296315; ENSP00000296315; ENSG00000163947 [Q9NR81-1]
ENST00000338458; ENSP00000341071; ENSG00000163947 [Q9NR81-2]
ENST00000413728; ENSP00000410922; ENSG00000163947 [Q9NR81-3]
GeneIDi50650
KEGGihsa:50650
UCSCiuc003dif.3, human [Q9NR81-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		50650
DisGeNETi50650

GeneCards: human genes, protein and diseases

More...GeneCardsi		ARHGEF3
HGNCiHGNC:683, ARHGEF3
HPAiENSG00000163947, Low tissue specificity
MIMi612115, gene
neXtProtiNX_Q9NR81
OpenTargetsiENSG00000163947
PharmGKBiPA24973
VEuPathDBiHostDB:ENSG00000163947.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4305, Eukaryota
GeneTreeiENSGT00940000158385
InParanoidiQ9NR81
OMAiPIPMKDL
OrthoDBi849206at2759
PhylomeDBiQ9NR81
TreeFamiTF328974

Enzyme and pathway databases

PathwayCommonsiQ9NR81
ReactomeiR-HSA-193648, NRAGE signals death through JNK
R-HSA-194840, Rho GTPase cycle
R-HSA-416482, G alpha (12/13) signalling events
SIGNORiQ9NR81

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		50650, 6 hits in 875 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ARHGEF3, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ARHGEF3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		50650
PharosiQ9NR81, Tbio

Protein Ontology

More...PROi		PR:Q9NR81
RNActiQ9NR81, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000163947, Expressed in metanephric glomerulus and 235 other tissues
ExpressionAtlasiQ9NR81, baseline and differential
GenevisibleiQ9NR81, HS

Family and domain databases

CDDicd10572, PH_RhoGEF3_XPLN, 1 hit
cd00160, RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR001331, GDS_CDC24_CS
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR044129, PH_RhoGEF3_XPLN
PfamiView protein in Pfam
PF00621, RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SM00325, RhoGEF, 1 hit
SUPFAMiSSF48065, SSF48065, 1 hit
PROSITEiView protein in PROSITE
PS00741, DH_1, 1 hit
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARHG3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NR81
Secondary accession number(s): A8K5U7
, Q4FZB6, Q4QQI5, Q4QQQ0, Q59F00, Q6NUN3, Q7Z4U2, Q7Z5T2, Q9H7T4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: October 1, 2000
Last modified: February 10, 2021
This is version 168 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with genetic variants
    List of human entries with genetic variants
  2. Human variants curated from literature reports
    Index of human variants curated from literature reports
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again