Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NQW7 (XPP1_HUMAN)

Entry version 173 (10 Feb 2021)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Xaa-Pro aminopeptidase 1

Gene

XPNPEP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide.2 Publications EC:3.4.11.9

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+2 PublicationsNote: Binds 2 manganese ions per subunit.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by apstatin and the metal ion chelators EDTA and 1,10-phenanthroline. Partially inhibited by dithiothreitol. Not inhibited by enalaprilat or amastatin.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=100.6 µM for bradykinin2 Publications
  2. KM=308 µM for the tripeptide Arg-Pro-Pro2 Publications

    pH dependencei

    Optimum pH is 8.2.2 Publications

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei77SubstrateBy similarity1
    Binding sitei395Substrate; via tele nitrogenBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi415Manganese 1Combined sources1 Publication1
    Metal bindingi426Manganese 1Combined sources1 Publication1
    Metal bindingi426Manganese 2Combined sources1 Publication1
    Metal bindingi489Manganese 2; via tele nitrogenCombined sources1 Publication1
    Binding sitei489Substrate; via tele nitrogenBy similarity1
    Binding sitei498Substrate; via tele nitrogenBy similarity1
    Metal bindingi523Manganese 2Combined sources1 Publication1
    Binding sitei523SubstrateBy similarity1
    Metal bindingi537Manganese 1Combined sources1 Publication1
    Metal bindingi537Manganese 2Combined sources1 Publication1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    GO - Biological processi

    Complete GO annotation on QuickGO ...

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionAminopeptidase, Hydrolase, Metalloprotease, Protease
    LigandManganese, Metal-binding

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...    BRENDAi    		3.1.8.1, 2681
    3.4.11.9, 2681

    Pathway Commons web resource for biological pathway data

    More...    PathwayCommonsi    		Q9NQW7

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...    SABIO-RKi    		Q9NQW7

    Protein family/group databases

    MEROPS protease database

    More...    MEROPSi    		M24.009

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Xaa-Pro aminopeptidase 1 (EC:3.4.11.9)
    Alternative name(s):
    Aminoacylproline aminopeptidase
    Cytosolic aminopeptidase P
    Soluble aminopeptidase P
    Short name:
    sAmp
    X-Pro aminopeptidase 1
    X-prolyl aminopeptidase 1, soluble
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:XPNPEP1Imported
    Synonyms:XPNPEPLImported, XPNPEPL1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

    Organism-specific databases

    Human Gene Nomenclature Database

    More...    HGNCi    		HGNC:12822, XPNPEP1

    Online Mendelian Inheritance in Man (OMIM)

    More...    MIMi    		602443, gene

    neXtProt; the human protein knowledge platform

    More...    neXtProti    		NX_Q9NQW7

    Eukaryotic Pathogen, Vector and Host Database Resources

    More...    VEuPathDBi    		HostDB:ENSG00000108039.17

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi41E → A: Reduces activity by 10%. 1 Publication1
    Mutagenesisi477W → E: Interferes with dimerization and reduces activity by 94%. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...    DisGeNETi    		7511

    Open Targets

    More...    OpenTargetsi    		ENSG00000108039

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...    PharmGKBi    		PA37415

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...    Pharosi    		Q9NQW7, Tchem

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...    ChEMBLi    		CHEMBL3782

    IUPHAR/BPS Guide to PHARMACOLOGY

    More...    GuidetoPHARMACOLOGYi    		1578

    Genetic variation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...    BioMutai    		XPNPEP1

    Domain mapping of disease mutations (DMDM)

    More...    DMDMi    		68566146

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001850832 – 623Xaa-Pro aminopeptidase 1Add BLAST622

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei304N6-acetyllysineCombined sources1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    The CPTAC Assay portal

    More...    CPTACi    		CPTAC-694
    CPTAC-695

    Encyclopedia of Proteome Dynamics

    More...    EPDi    		Q9NQW7

    jPOST - Japan Proteome Standard Repository/Database

    More...    jPOSTi    		Q9NQW7

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...    MassIVEi    		Q9NQW7

    MaxQB - The MaxQuant DataBase

    More...    MaxQBi    		Q9NQW7

    PaxDb, a database of protein abundance averages across all three domains of life

    More...    PaxDbi    		Q9NQW7

    PeptideAtlas

    More...    PeptideAtlasi    		Q9NQW7

    PRoteomics IDEntifications database

    More...    PRIDEi    		Q9NQW7

    ProteomicsDB: a multi-organism proteome resource

    More...    ProteomicsDBi    		34080
    34174
    82211 [Q9NQW7-1]
    82212 [Q9NQW7-2]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...    iPTMneti    		Q9NQW7

    MetOSite database of methionine sulfoxide sites

    More...    MetOSitei    		Q9NQW7

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...    PhosphoSitePlusi    		Q9NQW7

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...    Bgeei    		ENSG00000108039, Expressed in body of pancreas and 241 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More...    ExpressionAtlasi    		Q9NQW7, baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...    Genevisiblei    		Q9NQW7, HS

    Organism-specific databases

    Human Protein Atlas

    More...    HPAi    		ENSG00000108039, Low tissue specificity

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Homodimer.

    2 Publications

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    Hide details

    GO - Molecular functioni

    Complete GO annotation on QuickGO ...

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGRID)

    More...    BioGRIDi    		113346, 82 interactors

    Protein interaction database and analysis system

    More...    IntActi    		Q9NQW7, 16 interactors

    Molecular INTeraction database

    More...    MINTi    		Q9NQW7

    STRING: functional protein association networks

    More...    STRINGi    		9606.ENSP00000421566

    Chemistry databases

    BindingDB database of measured binding affinities

    More...    BindingDBi    		Q9NQW7

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...    RNActi    		Q9NQW7, protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1623
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...    SMRi    		Q9NQW7

    Database of comparative protein structure models

    More...    ModBasei    		Search...

    Protein Data Bank in Europe - Knowledge Base

    More...    PDBe-KBi    		Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...    EvolutionaryTracei    		Q9NQW7

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the peptidase M24B family.Sequence analysis

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...    eggNOGi    		KOG2413, Eukaryota

    Ensembl GeneTree

    More...    GeneTreei    		ENSGT00940000157716

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...    HOGENOMi    		CLU_011781_2_2_1

    InParanoid: Eukaryotic Ortholog Groups

    More...    InParanoidi    		Q9NQW7

    Identification of Orthologs from Complete Genome Data

    More...    OMAi    		YRPGKWG

    Database of Orthologous Groups

    More...    OrthoDBi    		417805at2759

    Database for complete collections of gene phylogenies

    More...    PhylomeDBi    		Q9NQW7

    TreeFam database of animal gene trees

    More...    TreeFami    		TF314183

    Family and domain databases

    Conserved Domains Database

    More...    CDDi    		cd01085, APP, 1 hit

    Gene3D Structural and Functional Annotation of Protein Families

    More...    Gene3Di    		3.40.350.10, 2 hits
    3.90.230.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...    InterProi    		View protein in InterPro
    IPR029149, Creatin/AminoP/Spt16_NTD
    IPR036005, Creatinase/aminopeptidase-like
    IPR000587, Creatinase_N
    IPR000994, Pept_M24
    IPR033740, Pept_M24B
    IPR032416, Peptidase_M24_C
    IPR001131, Peptidase_M24B_aminopep-P_CS

    Pfam protein domain database

    More...    Pfami    		View protein in Pfam
    PF01321, Creatinase_N, 1 hit
    PF00557, Peptidase_M24, 1 hit
    PF16188, Peptidase_M24_C, 1 hit

    Superfamily database of structural and functional annotation

    More...    SUPFAMi    		SSF53092, SSF53092, 1 hit
    SSF55920, SSF55920, 1 hit

    PROSITE; a protein domain and family database

    More...    PROSITEi    		View protein in PROSITE
    PS00491, PROLINE_PEPTIDASE, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 11 Publication (identifier: Q9NQW7-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MPPKVTSELL RQLRQAMRNS EYVTEPIQAY IIPSGDAHQS EYIAPCDCRR 
            60         70         80         90        100
    AFVSGFDGSA GTAIITEEHA AMWTDGRYFL QAAKQMDSNW TLMKMGLKDT 
           110        120        130        140        150
    PTQEDWLVSV LPEGSRVGVD PLIIPTDYWK KMAKVLRSAG HHLIPVKENL 
           160        170        180        190        200
    VDKIWTDRPE RPCKPLLTLG LDYTGISWKD KVADLRLKMA ERNVMWFVVT 
           210        220        230        240        250
    ALDEIAWLFN LRGSDVEHNP VFFSYAIIGL ETIMLFIDGD RIDAPSVKEH 
           260        270        280        290        300
    LLLDLGLEAE YRIQVHPYKS ILSELKALCA DLSPREKVWV SDKASYAVSE 
           310        320        330        340        350
    TIPKDHRCCM PYTPICIAKA VKNSAESEGM RRAHIKDAVA LCELFNWLEK 
           360        370        380        390        400
    EVPKGGVTEI SAADKAEEFR RQQADFVDLS FPTISSTGPN GAIIHYAPVP 
           410        420        430        440        450
    ETNRTLSLDE VYLIDSGAQY KDGTTDVTRT MHFGTPTAYE KECFTYVLKG 
           460        470        480        490        500
    HIAVSAAVFP TGTKGHLLDS FARSALWDSG LDYLHGTGHG VGSFLNVHEG 
           510        520        530        540        550
    PCGISYKTFS DEPLEAGMIV TDEPGYYEDG AFGIRIENVV LVVPVKTKYN 
           560        570        580        590        600
    FNNRGSLTFE PLTLVPIQTK MIDVDSLTDK ECDWLNNYHL TCRDVIGKEL 
           610        620 
    QKQGRQEALE WLIRETQPIS KQH
    Length:623
    Mass (Da):69,918
    Last modified:January 23, 2007 - v3
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDF4F5AF41E2F3876
    GO
    Isoform 2 (identifier: Q9NQW7-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         398-421: Missing.

    Show »
    Length:599
    Mass (Da):67,227
    Checksum:i6F6A7D909E1CC84D
    GO
    Isoform 3 (identifier: Q9NQW7-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAASRKPPRVRVNHQDFQLRNLRIIEPNEVTHSGDTGVETDGRM

    Show »
    Length:666
    Mass (Da):74,798
    Checksum:i59D0596A49C93B17
    GO
    Isoform 4 (identifier: Q9NQW7-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAASRKPPRVRVNHQDFQLRNLRIIEPNEVTHSGDTGVETDGRM
         398-421: Missing.

    Show »
    Length:642
    Mass (Da):72,107
    Checksum:i0119CDC61051D1C2
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    		Gene namesLengthAnnotation
    Q5T6H7Q5T6H7_HUMAN
    Xaa-Pro aminopeptidase 1
    XPNPEP1
    		552Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    Q5T6H2Q5T6H2_HUMAN
    Xaa-Pro aminopeptidase 1
    XPNPEP1
    		303Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    Q5T6H3Q5T6H3_HUMAN
    Xaa-Pro aminopeptidase 1
    XPNPEP1
    		233Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence CAD38640 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti90W → C in AAH13417 (PubMed:15489334).Curated1
    Sequence conflicti131K → R in BAF82125 (PubMed:14702039).Curated1
    Sequence conflicti332R → P in CAA65068 (PubMed:9465902).Curated1
    Sequence conflicti332R → P in AAF97866 (PubMed:10871044).Curated1
    Sequence conflicti496N → D in BAD97233 (PubMed:17974005).Curated1
    Sequence conflicti498H → R in BAD97233 (PubMed:17974005).Curated1
    Sequence conflicti572I → T in BAF82125 (PubMed:14702039).Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0452501M → MAASRKPPRVRVNHQDFQLR NLRIIEPNEVTHSGDTGVET DGRM in isoform 3 and isoform 4. 1 Publication1
    Alternative sequenceiVSP_051752398 – 421Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST24

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...    EMBLi

    GenBank nucleotide sequence database

    More...    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...    DDBJi
    Links Updated
    		X95762 mRNA Translation: CAA65068.1
    AF195530 mRNA Translation: AAF97866.1
    AF272981 mRNA Translation: AAF75795.1
    AK289436 mRNA Translation: BAF82125.1
    CR456922 mRNA Translation: CAG33203.1
    AK223513 mRNA Translation: BAD97233.1
    AL833411 mRNA Translation: CAD38640.1 Different initiation.
    AL354951 Genomic DNA No translation available.
    CH471066 Genomic DNA Translation: EAW49577.1
    BC005126 mRNA Translation: AAH05126.1
    BC007579 mRNA Translation: AAH07579.1
    BC013417 mRNA Translation: AAH13417.4

    The Consensus CDS (CCDS) project

    More...    CCDSi    		CCDS53576.1 [Q9NQW7-4]
    CCDS7560.2 [Q9NQW7-3]

    NCBI Reference Sequences

    More...    RefSeqi    		NP_001161076.1, NM_001167604.1 [Q9NQW7-4]
    NP_001311061.1, NM_001324132.1 [Q9NQW7-1]
    NP_065116.3, NM_020383.3 [Q9NQW7-3]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...    Ensembli    		ENST00000322238; ENSP00000324011; ENSG00000108039 [Q9NQW7-4]
    ENST00000502935; ENSP00000421566; ENSG00000108039 [Q9NQW7-3]

    Database of genes from NCBI RefSeq genomes

    More...    GeneIDi    		7511

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...    KEGGi    		hsa:7511

    UCSC genome browser

    More...    UCSCi    		uc001kyp.2, human [Q9NQW7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    		X95762 mRNA Translation: CAA65068.1
    AF195530 mRNA Translation: AAF97866.1
    AF272981 mRNA Translation: AAF75795.1
    AK289436 mRNA Translation: BAF82125.1
    CR456922 mRNA Translation: CAG33203.1
    AK223513 mRNA Translation: BAD97233.1
    AL833411 mRNA Translation: CAD38640.1 Different initiation.
    AL354951 Genomic DNA No translation available.
    CH471066 Genomic DNA Translation: EAW49577.1
    BC005126 mRNA Translation: AAH05126.1
    BC007579 mRNA Translation: AAH07579.1
    BC013417 mRNA Translation: AAH13417.4
    CCDSiCCDS53576.1 [Q9NQW7-4]
    CCDS7560.2 [Q9NQW7-3]
    RefSeqiNP_001161076.1, NM_001167604.1 [Q9NQW7-4]
    NP_001311061.1, NM_001324132.1 [Q9NQW7-1]
    NP_065116.3, NM_020383.3 [Q9NQW7-3]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...    PDBei

    Protein Data Bank RCSB

    More...    RCSB PDBi

    Protein Data Bank Japan

    More...    PDBji
    Links Updated
    		PDB entryMethodResolution (Å)ChainPositionsPDBsum
    3CTZX-ray1.60A1-623[»]
    SMRiQ9NQW7
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGRIDi113346, 82 interactors
    IntActiQ9NQW7, 16 interactors
    MINTiQ9NQW7
    STRINGi9606.ENSP00000421566

    Chemistry databases

    BindingDBiQ9NQW7
    ChEMBLiCHEMBL3782
    GuidetoPHARMACOLOGYi1578

    Protein family/group databases

    MEROPSiM24.009

    PTM databases

    iPTMnetiQ9NQW7
    MetOSiteiQ9NQW7
    PhosphoSitePlusiQ9NQW7

    Genetic variation databases

    BioMutaiXPNPEP1
    DMDMi68566146

    Proteomic databases

    CPTACiCPTAC-694
    CPTAC-695
    EPDiQ9NQW7
    jPOSTiQ9NQW7
    MassIVEiQ9NQW7
    MaxQBiQ9NQW7
    PaxDbiQ9NQW7
    PeptideAtlasiQ9NQW7
    PRIDEiQ9NQW7
    ProteomicsDBi34080
    34174
    82211 [Q9NQW7-1]
    82212 [Q9NQW7-2]

    Protocols and materials databases

    ABCD curated depository of sequenced antibodies

    More...    ABCDi    		Q9NQW7, 2 sequenced antibodies

    Antibodypedia a portal for validated antibodies

    More...    Antibodypediai    		31645, 185 antibodies

    The DNASU plasmid repository

    More...    DNASUi    		7511

    Genome annotation databases

    EnsembliENST00000322238; ENSP00000324011; ENSG00000108039 [Q9NQW7-4]
    ENST00000502935; ENSP00000421566; ENSG00000108039 [Q9NQW7-3]
    GeneIDi7511
    KEGGihsa:7511
    UCSCiuc001kyp.2, human [Q9NQW7-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...    CTDi    		7511
    DisGeNETi7511

    GeneCards: human genes, protein and diseases

    More...    GeneCardsi    		XPNPEP1
    HGNCiHGNC:12822, XPNPEP1
    HPAiENSG00000108039, Low tissue specificity
    MIMi602443, gene
    neXtProtiNX_Q9NQW7
    OpenTargetsiENSG00000108039
    PharmGKBiPA37415
    VEuPathDBiHostDB:ENSG00000108039.17

    GenAtlas: human gene database

    More...    GenAtlasi    		Search...

    Phylogenomic databases

    eggNOGiKOG2413, Eukaryota
    GeneTreeiENSGT00940000157716
    HOGENOMiCLU_011781_2_2_1
    InParanoidiQ9NQW7
    OMAiYRPGKWG
    OrthoDBi417805at2759
    PhylomeDBiQ9NQW7
    TreeFamiTF314183

    Enzyme and pathway databases

    BRENDAi3.1.8.1, 2681
    3.4.11.9, 2681
    PathwayCommonsiQ9NQW7
    SABIO-RKiQ9NQW7

    Miscellaneous databases

    BioGRID ORCS database of CRISPR phenotype screens

    More...    BioGRID-ORCSi    		7511, 9 hits in 878 CRISPR screens

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...    ChiTaRSi    		XPNPEP1, human
    EvolutionaryTraceiQ9NQW7

    The Gene Wiki collection of pages on human genes and proteins

    More...    GeneWikii    		XPNPEP1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...    GenomeRNAii    		7511
    PharosiQ9NQW7, Tchem

    Protein Ontology

    More...    PROi    		PR:Q9NQW7
    RNActiQ9NQW7, protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...    SOURCEi    		Search...

    Gene expression databases

    BgeeiENSG00000108039, Expressed in body of pancreas and 241 other tissues
    ExpressionAtlasiQ9NQW7, baseline and differential
    GenevisibleiQ9NQW7, HS

    Family and domain databases

    CDDicd01085, APP, 1 hit
    Gene3Di3.40.350.10, 2 hits
    3.90.230.10, 1 hit
    InterProiView protein in InterPro
    IPR029149, Creatin/AminoP/Spt16_NTD
    IPR036005, Creatinase/aminopeptidase-like
    IPR000587, Creatinase_N
    IPR000994, Pept_M24
    IPR033740, Pept_M24B
    IPR032416, Peptidase_M24_C
    IPR001131, Peptidase_M24B_aminopep-P_CS
    PfamiView protein in Pfam
    PF01321, Creatinase_N, 1 hit
    PF00557, Peptidase_M24, 1 hit
    PF16188, Peptidase_M24_C, 1 hit
    SUPFAMiSSF53092, SSF53092, 1 hit
    SSF55920, SSF55920, 1 hit
    PROSITEiView protein in PROSITE
    PS00491, PROLINE_PEPTIDASE, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...    ProtoNeti    		Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...    MobiDBi    		Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiXPP1_HUMAN
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQW7
    Secondary accession number(s): A8K071
    , G5E9Y2, G8JLB2, O15250, Q53EX6, Q8N3Q0, Q96D23
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
    Last sequence update: January 23, 2007
    Last modified: February 10, 2021
    This is version 173 of the entry and version 3 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families
    5. Peptidase families
      Classification of peptidase families and list of entries
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again