Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q9NQB0 (TF7L2_HUMAN)

Entry version 213 (23 Feb 2022)
Sequence version 2 (25 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Transcription factor 7-like 2

Gene

TCF7L2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Participates in the Wnt signaling pathway and modulates MYC expression by binding to its promoter in a sequence-specific manner. Acts as repressor in the absence of CTNNB1, and as activator in its presence. Activates transcription from promoters with several copies of the Tcf motif 5'-CCTTTGATC-3' in the presence of CTNNB1. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7L2/TCF4 and CTNNB1. Expression of dominant-negative mutants results in cell-cycle arrest in G1. Necessary for the maintenance of the epithelial stem-cell compartment of the small intestine.

5 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi350 – 418HMG boxPROSITE-ProRule annotationAdd BLAST69

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9NQB0

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-201722, Formation of the beta-catenin:TCF transactivating complex
R-HSA-3769402, Deactivation of the beta-catenin transactivating complex
R-HSA-381771, Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
R-HSA-4086398, Ca2+ pathway
R-HSA-4411364, Binding of TCF/LEF:CTNNB1 to target gene promoters
R-HSA-4641265, Repression of WNT target genes
R-HSA-5339700, Signaling by TCF7L2 mutants
R-HSA-8853884, Transcriptional Regulation by VENTX
R-HSA-8951430, RUNX3 regulates WNT signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9NQB0

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9NQB0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor 7-like 2
Alternative name(s):
HMG box transcription factor 4
T-cell-specific transcription factor 4
Short name:
T-cell factor 4
Short name:
TCF-4
Short name:
hTCF-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TCF7L2
Synonyms:TCF4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11641, TCF7L2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602228, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NQB0

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000148737

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Constitutive activation and subsequent transactivation of target genes may lead to the maintenance of stem-cell characteristics (cycling and longevity) in cells that should normally undergo terminal differentiation and constitute the primary transforming event in colorectal cancer (CRC).
Diabetes mellitus, non-insulin-dependent (NIDDM)2 Publications
Disease susceptibility is associated with variants affecting the gene represented in this entry.
Disease descriptionA multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to the body's own insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
Related information in OMIM

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi10 – 11DD → AA: Reduces CTNNB1 binding. 1 Publication2
Mutagenesisi16D → A: Abolishes CTNNB1 binding. 1 Publication1
Mutagenesisi17E → A: Reduces CTNNB1 binding. 1 Publication1
Mutagenesisi19I → A: Reduces transcription activation. 1 Publication1
Mutagenesisi21F → A: Reduces transcription activation. 1 Publication1
Mutagenesisi23 – 24DE → AA: Reduces CTNNB1 binding. 1 Publication2
Mutagenesisi24E → A: Reduces CTNNB1 binding, and abolishes CTNNB1 binding; when associated with A-26; A-28 and A-29. 1 Publication1
Mutagenesisi26E → A: Abolishes CTNNB1 binding; when associated with A-24; A-28 and A-29. 1 Publication1
Mutagenesisi28E → A: Abolishes CTNNB1 binding; when associated with A-24; A-26 and A-29. 1 Publication1
Mutagenesisi29E → A: Reduces CTNNB1 binding, and abolishes CTNNB1 binding; when associated with A-24; A-26 and A-28. 1 Publication1
Mutagenesisi48L → A: Abolishes CTNNB1 binding. 1 Publication1
Mutagenesisi201T → V: Reduced phosphorylation by NLK and enhanced DNA-binding; when associated with V-212. 1 Publication1
Mutagenesisi212T → V: Reduced phosphorylation by NLK and enhanced DNA-binding; when associated with V-201. 1 Publication1
Mutagenesisi320K → R: Loss of sumoylation. No effect on localization to nuclear bodies. 1 Publication1
Mutagenesisi322E → A: Loss of sumoylation. 1 Publication1

Keywords - Diseasei

Diabetes mellitus

Organism-specific databases

DisGeNET

More...DisGeNETi		6934

MalaCards human disease database

More...MalaCardsi		TCF7L2
MIMi125853, phenotype

Open Targets

More...OpenTargetsi		ENSG00000148737

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36394

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NQB0, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3038511

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TCF7L2

Domain mapping of disease mutations (DMDM)

More...DMDMi		29337146

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000486231 – 619Transcription factor 7-like 2Add BLAST619

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki22Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei201Phosphothreonine; by NLK1 Publication1
Modified residuei212Phosphothreonine; by NLK1 Publication1
Cross-linki320Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)1 Publication
Cross-linki539Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

In vitro, phosphorylated by TNIK.1 Publication
Phosphorylated at Thr-201 and/or Thr-212 by NLK. Phosphorylation by NLK at these sites inhibits DNA-binding by TCF7L2/TCF4, thereby preventing transcriptional activation of target genes of the canonical Wnt/beta-catenin signaling pathway.1 Publication
Polysumoylated. Sumoylation is enhanced by PIAS family members and desumoylation is enhanced by SENP2. Sumoylation/desumoylation regulates TCF7L2/TCF4 transcription activity in the Wnt/beta-catenin signaling pathway without altering interaction with CTNNB1 nor binding to DNA.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NQB0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NQB0

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9NQB0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NQB0

PeptideAtlas

More...PeptideAtlasi		Q9NQB0

PRoteomics IDEntifications database

More...PRIDEi		Q9NQB0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		15216
29884
30005
82120 [Q9NQB0-1]
82121 [Q9NQB0-10]
82122 [Q9NQB0-2]
82123 [Q9NQB0-3]
82124 [Q9NQB0-4]
82125 [Q9NQB0-5]
82126 [Q9NQB0-6]
82127 [Q9NQB0-7]
82128 [Q9NQB0-8]
82129 [Q9NQB0-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NQB0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NQB0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in epithelium from small intestine, with the highest expression at the top of the crypts and a gradient of expression from crypt to villus. Detected in colon epithelium and colon cancer, and in epithelium from mammary gland and carcinomas derived therefrom.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Highly expressed in crypt regions and barely detectable in villi in epithelium from fetal small intestine at week 16. At week 22 expression in villi had increased strongly.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000148737, Expressed in lateral nuclear group of thalamus and 242 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NQB0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NQB0, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000148737, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TGFB1I1 (By similarity).

Interacts with CTNNB1 (via the armadillo repeat); forms stable transcription complex (PubMed:9065401, PubMed:9916915, PubMed:10080941, PubMed:19816403, PubMed:28829046, PubMed:29739711, PubMed:17052462).

Interacts with EP300.

Interacts with NLK.

Interacts with CCDC85B (probably through the HMG box); prevents interaction with CTNNB1.

Interacts with TNIK.

Interacts with MAD2L2; prevents TCF7L2/TCF4 binding to promZIPK/DAPK3oters, negatively modulating its transcriptional activity.

Interacts with ZIPK/DAPK3.

Interacts with XIAP/BIRC4 and TLE3.

Interacts with DDIT3/CHOP. The CTNNB1 and TCF7L2/TCF4 complex interacts with PML (isoform PML-4).

Identified in a complex with CTNNB1 and FERMT2.

Interacts with SPIN1 (PubMed:22258766, PubMed:24589551, PubMed:29061846).

Interacts with C11orf84/SPINDOC in a SPIN1-dependent manner (PubMed:29061846).

By similarity22 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112795, 213 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9NQB0

Database of interacting proteins

More...DIPi		DIP-36236N

Protein interaction database and analysis system

More...IntActi		Q9NQB0, 154 interactors

Molecular INTeraction database

More...MINTi		Q9NQB0

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000358404

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9NQB0

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NQB0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1619
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NQB0

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9NQB0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 96DisorderedSequence analysisAdd BLAST96
Regioni1 – 53CTNNB1-bindingBy similarityAdd BLAST53
Regioni201 – 395Mediates interaction with MAD2L21 PublicationAdd BLAST195
Regioni318 – 350DisorderedSequence analysisAdd BLAST33
Regioni420 – 441DisorderedSequence analysisAdd BLAST22
Regioni459 – 505Promoter-specific activation domainAdd BLAST47
Regioni496 – 547DisorderedSequence analysisAdd BLAST52
Regioni574 – 619DisorderedSequence analysisAdd BLAST46

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi425 – 430Nuclear localization signalSequence analysis6

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi16 – 46Basic and acidic residuesSequence analysisAdd BLAST31
Compositional biasi47 – 63Polar residuesSequence analysisAdd BLAST17
Compositional biasi64 – 91Basic and acidic residuesSequence analysisAdd BLAST28
Compositional biasi318 – 332Polar residuesSequence analysisAdd BLAST15
Compositional biasi333 – 350Basic and acidic residuesSequence analysisAdd BLAST18
Compositional biasi520 – 537Polar residuesSequence analysisAdd BLAST18
Compositional biasi584 – 619Polar residuesSequence analysisAdd BLAST36

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The promoter-specific activation domain interacts with the transcriptional coactivator EP300.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TCF/LEF family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3248, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155535

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_013229_5_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NQB0

Identification of Orthologs from Complete Genome Data

More...OMAi		SLPPITX

Database of Orthologous Groups

More...OrthoDBi		807716at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NQB0

TreeFam database of animal gene trees

More...TreeFami		TF318448

Family and domain databases

Database of protein disorder

More...DisProti		DP00175

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.30.10, 1 hit
4.10.900.10, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00100

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR027397, Catenin-bd_sf
IPR013558, CTNNB1-bd_N
IPR009071, HMG_box_dom
IPR036910, HMG_box_dom_sf
IPR024940, TCF/LEF

The PANTHER Classification System

More...PANTHERi		PTHR10373, PTHR10373, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08347, CTNNB1_binding, 1 hit
PF00505, HMG_box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00398, HMG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47095, SSF47095, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50118, HMG_BOX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (17+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 17 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 17 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NQB0-1) [UniParc]FASTAAdd to basket
Also known as: TCF-4M

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPQLNGGGGD DLGANDELIS FKDEGEQEEK SSENSSAERD LADVKSSLVN 
        60         70         80         90        100
ESETNQNSSS DSEAERRPPP RSESFRDKSR ESLEEAAKRQ DGGLFKGPPY 
       110        120        130        140        150
PGYPFIMIPD LTSPYLPNGS LSPTARTLHF QSGSTHYSAY KTIEHQIAVQ 
       160        170        180        190        200
YLQMKWPLLD VQAGSLQSRQ ALKDARSPSP AHIVSNKVPV VQHPHHVHPL 
       210        220        230        240        250
TPLITYSNEH FTPGNPPPHL PADVDPKTGI PRPPHPPDIS PYYPLSPGTV 
       260        270        280        290        300
GQIPHPLGWL VPQQGQPVYP ITTGGFRHPY PTALTVNASM SRFPPHMVPP 
       310        320        330        340        350
HHTLHTTGIP HPAIVTPTVK QESSQSDVGS LHSSKHQDSK KEEEKKKPHI 
       360        370        380        390        400
KKPLNAFMLY MKEMRAKVVA ECTLKESAAI NQILGRRWHA LSREEQAKYY 
       410        420        430        440        450
ELARKERQLH MQLYPGWSAR DNYGKKKKRK RDKQPGETNE HSECFLNPCL 
       460        470        480        490        500
SLPPITDLSA PKKCRARFGL DQQNNWCGPC RRKKKCVRYI QGEGSCLSPP 
       510        520        530        540        550
SSDGSLLDSP PPSPNLLGSP PRDAKSQTEQ TQPLSLSLKP DPLAHLSMMP 
       560        570        580        590        600
PPPALLLAEA THKASALCPN GALDLPPAAL QPAAPSSSIA QPSTSSLHSH 
       610 
SSLAGTQPQP LSLVTKSLE
Length:619
Mass (Da):67,919
Last modified:March 25, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4DD2D3CC814AE16E
GO
Isoform 2 (identifier: Q9NQB0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     482-494: RKKKCVRYIQGEG → CKYSKEVSGTVRA
     495-619: Missing.

Show »
Length:494
Mass (Da):55,152
Checksum:iAC0B8049DF6F4498
GO
Isoform 3 (identifier: Q9NQB0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     457-478: DLSAPKKCRARFGLDQQNNWCG → DANTPKKCRALFGLDRQTLWCK

Show »
Length:619
Mass (Da):67,976
Checksum:i6F0250E096854CC0
GO
Isoform 4 (identifier: Q9NQB0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     440-456: Missing.
     482-494: RKKKCVRYIQGEG → CKYSKEVSGTVRA
     495-619: Missing.

Show »
Length:477
Mass (Da):53,270
Checksum:i380199CA672A41A8
GO
Isoform 5 (identifier: Q9NQB0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     440-456: Missing.

Show »
Length:602
Mass (Da):66,037
Checksum:iA52CA392A33AB61C
GO
Isoform 6 (identifier: Q9NQB0-6) [UniParc]FASTAAdd to basket
Also known as: TCF-4I

The sequence of this isoform differs from the canonical sequence as follows:
     457-619: DLSAPKKCRA...PLSLVTKSLE → GEKKSAFATYKVKAAASAHPLQMEAY

Show »
Length:482
Mass (Da):53,676
Checksum:iB68AD303BF9F3E25
GO
Isoform 7 (identifier: Q9NQB0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     440-456: Missing.
     457-478: DLSAPKKCRARFGLDQQNNWCG → DANTPKKCRALFGLDRQTLWCK

Show »
Length:602
Mass (Da):66,094
Checksum:i87FC20BEB4F51BB2
GO
Isoform 8 (identifier: Q9NQB0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.

Show »
Length:596
Mass (Da):65,291
Checksum:iA022284FEC164B09
GO
Isoform 9 (identifier: Q9NQB0-9) [UniParc]FASTAAdd to basket
Also known as: TCF-4G

The sequence of this isoform differs from the canonical sequence as follows:
     440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY
     466-619: Missing.

Show »
Length:465
Mass (Da):51,794
Checksum:i5E1E47B5DCB132BE
GO
Isoform 10 (identifier: Q9NQB0-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     260-263: Missing.
     457-482: DLSAPKKCRARFGLDQQNNWCGPCRR → GEKKSAFATYKVKAAASAHPLQMEAY
     483-619: Missing.

Show »
Length:455
Mass (Da):50,611
Checksum:i2775B43A2E392581
GO
Isoform 11 (identifier: Q9NQB0-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     184-184: V → VSPLPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCIE
     440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY
     466-619: Missing.

Show »
Length:489
Mass (Da):54,572
Checksum:i9817D6DB995CBCD2
GO
Isoform 12 (identifier: Q9NQB0-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     481-619: RRKKKCVRYI...PLSLVTKSLE → SL

Note: Low expression in pancreas and colon.Curated
Show »
Length:459
Mass (Da):51,159
Checksum:i59C37C6D178BD813
GO
Isoform 13 (identifier: Q9NQB0-13) [UniParc]FASTAAdd to basket
Also known as: TCF-4J

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     440-456: Missing.
     457-478: DLSAPKKCRARFGLDQQNNWCG → DANTPKKCRALFGLDRQTLWCK

Note: Common splicing form, lowest expression in skeletal muscle.Curated
Show »
Length:579
Mass (Da):63,466
Checksum:iB2DEA916F03B0F63
GO
Isoform 14 (identifier: Q9NQB0-14) [UniParc]FASTAAdd to basket
Also known as: TCF-4B, short

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY
     466-619: Missing.

Note: High transcriptional activity. Major isoform in liver.Curated
Show »
Length:442
Mass (Da):49,166
Checksum:i57D7E679A87FF4C3
GO
Isoform 15 (identifier: Q9NQB0-15) [UniParc]FASTAAdd to basket
Also known as: TCF-4A

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     290-290: M → MSSFLS
     440-465: EHSECFLNPCLSLPPITDLSAPKKCR → GEKKSAFATYKVKAAASAHPLQMEAY
     466-619: Missing.

Show »
Length:447
Mass (Da):49,688
Checksum:i1363601E57F2AA39
GO
Isoform 16 (identifier: Q9NQB0-16) [UniParc]FASTAAdd to basket
Also known as: TCF-4K

The sequence of this isoform differs from the canonical sequence as follows:
     128-150: Missing.
     290-290: M → MSSFLS
     440-456: Missing.

Show »
Length:584
Mass (Da):63,930
Checksum:i7AA2B6E62420108B
GO
Isoform 17 (identifier: Q9NQB0-17) [UniParc]FASTAAdd to basket
Also known as: TCF-4X2

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MPQLNG → MSSFLS
     7-290: Missing.

Show »
Length:335
Mass (Da):36,884
Checksum:i6085EDAAE3D893A5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTL7A0A0A0MTL7_HUMAN
Transcription factor 7-like 2
TCF7L2
408Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5VVR7Q5VVR7_HUMAN
TCF7L2 isoform pFC8A_TCF7L2_H7_ex1-...
TCF7L2
455Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C6ZRJ7C6ZRJ7_HUMAN
TCF7L2 isoform pFC8A_TCF7L2_A3,ex1-...
TCF7L2
476Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C6ZRK5C6ZRK5_HUMAN
TCF7L2 isoform pFC8A_TCF7L2_ex1-11-...
TCF7L2 hCG_40998
579Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SGH8A0A0D9SGH8_HUMAN
Transcription factor 7-like 2
TCF7L2
584Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JRY3Q5JRY3_HUMAN
Transcription factor 7-like 2
TCF7L2
157Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JRY5Q5JRY5_HUMAN
Transcription factor 7-like 2
TCF7L2
206Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E2GH26E2GH26_HUMAN
T-cell factor-4 variant L
TCF7L2
607Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C6ZRJ6C6ZRJ6_HUMAN
TCF7L2 isoform pFC8A_TCF7L2_D5_ex3,...
TCF7L2
534Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YEE5H0YEE5_HUMAN
Transcription factor 7-like 2
TCF7L2
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti118 – 121NGSL → KRSV in CAB97212 (PubMed:10919662).Curated4
Sequence conflicti118 – 121NGSL → KRSV in CAB97213 (PubMed:10919662).Curated4
Sequence conflicti167Q → R in ADK35180 (PubMed:21256126).Curated1
Sequence conflicti226P → L in ADK35180 (PubMed:21256126).Curated1
Sequence conflicti290M → V in CAA72166 (PubMed:9065401).Curated1
Sequence conflicti331L → H in ACI28527 (PubMed:19602480).Curated1
Sequence conflicti596S → W in CAA72166 (PubMed:9065401).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047126346K → N1 PublicationCorresponds to variant dbSNP:rs2757884Ensembl.1
Natural variantiVAR_035939465R → C in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0537481 – 6MPQLNG → MSSFLS in isoform 17. 1 Publication6
Alternative sequenceiVSP_0537497 – 290Missing in isoform 17. 1 PublicationAdd BLAST284
Alternative sequenceiVSP_006962128 – 150Missing in isoform 8, isoform 10, isoform 11, isoform 12, isoform 13, isoform 14, isoform 15 and isoform 16. 5 PublicationsAdd BLAST23
Alternative sequenceiVSP_045821184V → VSPLPCCTQGHDCQHFYPPS DFTVSTQVFRDMKRSHSLQK VGEPWCIE in isoform 11. Curated1
Alternative sequenceiVSP_006963260 – 263Missing in isoform 10. 1 Publication4
Alternative sequenceiVSP_053750290M → MSSFLS in isoform 15 and isoform 16. 1 Publication1
Alternative sequenceiVSP_006965440 – 465EHSEC…PKKCR → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 9, isoform 11, isoform 14 and isoform 15. 5 PublicationsAdd BLAST26
Alternative sequenceiVSP_006964440 – 456Missing in isoform 4, isoform 5, isoform 7, isoform 13 and isoform 16. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_006967457 – 619DLSAP…TKSLE → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 6. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_006968457 – 482DLSAP…GPCRR → GEKKSAFATYKVKAAASAHP LQMEAY in isoform 10. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_006966457 – 478DLSAP…NNWCG → DANTPKKCRALFGLDRQTLW CK in isoform 3, isoform 7 and isoform 13. 2 PublicationsAdd BLAST22
Alternative sequenceiVSP_006969466 – 619Missing in isoform 9, isoform 11, isoform 14 and isoform 15. 5 PublicationsAdd BLAST154
Alternative sequenceiVSP_045822481 – 619RRKKK…TKSLE → SL in isoform 12. 1 PublicationAdd BLAST139
Alternative sequenceiVSP_006970482 – 494RKKKC…IQGEG → CKYSKEVSGTVRA in isoform 2 and isoform 4. CuratedAdd BLAST13
Alternative sequenceiVSP_006971483 – 619Missing in isoform 10. 1 PublicationAdd BLAST137
Alternative sequenceiVSP_006972495 – 619Missing in isoform 2 and isoform 4. CuratedAdd BLAST125

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y11306 mRNA Translation: CAA72166.2
AJ270770 AJ270778 Genomic DNA Translation: CAB97212.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97213.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97214.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97215.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97216.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97217.1
AJ270770 AJ270777 Genomic DNA Translation: CAB97218.1
AJ270770 AJ270777 Genomic DNA Translation: CAB97219.1
FJ010167 mRNA Translation: ACI28525.1
FJ010169 mRNA Translation: ACI28527.1
FJ010172 mRNA Translation: ACI28530.1
HM352839 mRNA Translation: ADK35175.1
HM352842 mRNA Translation: ADK35178.1
HM352844 mRNA Translation: ADK35180.1
HM352845 mRNA Translation: ADK35187.1
HM352846 mRNA Translation: ADK35181.1
HM352847 mRNA Translation: ADK35182.1
HM352849 mRNA Translation: ADK35184.1
HM352850 mRNA Translation: ADK35185.1
AB440195 mRNA Translation: BAH24004.1
AK299295 mRNA Translation: BAG61310.1
AL135792 Genomic DNA No translation available.
AL158212 Genomic DNA No translation available.
AL445486 Genomic DNA No translation available.
AL451084 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49513.1
CH471066 Genomic DNA Translation: EAW49515.1
CH471066 Genomic DNA Translation: EAW49516.1
BC032656 mRNA Translation: AAH32656.1
AB034691 mRNA Translation: BAA86225.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS53577.1 [Q9NQB0-7]
CCDS53578.1 [Q9NQB0-11]
CCDS55729.1 [Q9NQB0-12]
CCDS7576.1 [Q9NQB0-8]
CCDS86148.1 [Q9NQB0-6]

Protein sequence database of the Protein Information Resource

More...PIRi		S22807

NCBI Reference Sequences

More...RefSeqi		NP_001139746.1, NM_001146274.1 [Q9NQB0-7]
NP_001139755.1, NM_001146283.1 [Q9NQB0-11]
NP_001139756.1, NM_001146284.1 [Q9NQB0-10]
NP_001139758.1, NM_001146286.1 [Q9NQB0-14]
NP_001185455.1, NM_001198526.1 [Q9NQB0-13]
NP_001185457.1, NM_001198528.1 [Q9NQB0-12]
NP_001185460.1, NM_001198531.1 [Q9NQB0-9]
XP_005270141.1, XM_005270084.1
XP_005270146.1, XM_005270089.1
XP_005270153.1, XM_005270096.2
XP_005270160.1, XM_005270103.1
XP_016872081.1, XM_017016592.1
XP_016872082.1, XM_017016593.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000352065; ENSP00000344823; ENSG00000148737 [Q9NQB0-12]
ENST00000355717; ENSP00000347949; ENSG00000148737 [Q9NQB0-11]
ENST00000355995; ENSP00000348274; ENSG00000148737
ENST00000369397; ENSP00000358404; ENSG00000148737 [Q9NQB0-8]
ENST00000538897; ENSP00000446172; ENSG00000148737 [Q9NQB0-6]
ENST00000627217; ENSP00000486891; ENSG00000148737 [Q9NQB0-7]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6934

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6934

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000627217.3; ENSP00000486891.1; NM_001146274.2; NP_001139746.1 [Q9NQB0-7]

UCSC genome browser

More...UCSCi		uc001lac.5, human [Q9NQB0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y11306 mRNA Translation: CAA72166.2
AJ270770 AJ270778 Genomic DNA Translation: CAB97212.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97213.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97214.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97215.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97216.1
AJ270770 AJ270778 Genomic DNA Translation: CAB97217.1
AJ270770 AJ270777 Genomic DNA Translation: CAB97218.1
AJ270770 AJ270777 Genomic DNA Translation: CAB97219.1
FJ010167 mRNA Translation: ACI28525.1
FJ010169 mRNA Translation: ACI28527.1
FJ010172 mRNA Translation: ACI28530.1
HM352839 mRNA Translation: ADK35175.1
HM352842 mRNA Translation: ADK35178.1
HM352844 mRNA Translation: ADK35180.1
HM352845 mRNA Translation: ADK35187.1
HM352846 mRNA Translation: ADK35181.1
HM352847 mRNA Translation: ADK35182.1
HM352849 mRNA Translation: ADK35184.1
HM352850 mRNA Translation: ADK35185.1
AB440195 mRNA Translation: BAH24004.1
AK299295 mRNA Translation: BAG61310.1
AL135792 Genomic DNA No translation available.
AL158212 Genomic DNA No translation available.
AL445486 Genomic DNA No translation available.
AL451084 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49513.1
CH471066 Genomic DNA Translation: EAW49515.1
CH471066 Genomic DNA Translation: EAW49516.1
BC032656 mRNA Translation: AAH32656.1
AB034691 mRNA Translation: BAA86225.1
CCDSiCCDS53577.1 [Q9NQB0-7]
CCDS53578.1 [Q9NQB0-11]
CCDS55729.1 [Q9NQB0-12]
CCDS7576.1 [Q9NQB0-8]
CCDS86148.1 [Q9NQB0-6]
PIRiS22807
RefSeqiNP_001139746.1, NM_001146274.1 [Q9NQB0-7]
NP_001139755.1, NM_001146283.1 [Q9NQB0-11]
NP_001139756.1, NM_001146284.1 [Q9NQB0-10]
NP_001139758.1, NM_001146286.1 [Q9NQB0-14]
NP_001185455.1, NM_001198526.1 [Q9NQB0-13]
NP_001185457.1, NM_001198528.1 [Q9NQB0-12]
NP_001185460.1, NM_001198531.1 [Q9NQB0-9]
XP_005270141.1, XM_005270084.1
XP_005270146.1, XM_005270089.1
XP_005270153.1, XM_005270096.2
XP_005270160.1, XM_005270103.1
XP_016872081.1, XM_017016592.1
XP_016872082.1, XM_017016593.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JDHX-ray1.90B12-49[»]
1JPWX-ray2.50D/E/F6-54[»]
2GL7X-ray2.60B/E1-53[»]
SMRiQ9NQB0
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112795, 213 interactors
CORUMiQ9NQB0
DIPiDIP-36236N
IntActiQ9NQB0, 154 interactors
MINTiQ9NQB0
STRINGi9606.ENSP00000358404

Chemistry databases

BindingDBiQ9NQB0
ChEMBLiCHEMBL3038511

PTM databases

iPTMnetiQ9NQB0
PhosphoSitePlusiQ9NQB0

Genetic variation databases

BioMutaiTCF7L2
DMDMi29337146

Proteomic databases

jPOSTiQ9NQB0
MassIVEiQ9NQB0
MaxQBiQ9NQB0
PaxDbiQ9NQB0
PeptideAtlasiQ9NQB0
PRIDEiQ9NQB0
ProteomicsDBi15216
29884
30005
82120 [Q9NQB0-1]
82121 [Q9NQB0-10]
82122 [Q9NQB0-2]
82123 [Q9NQB0-3]
82124 [Q9NQB0-4]
82125 [Q9NQB0-5]
82126 [Q9NQB0-6]
82127 [Q9NQB0-7]
82128 [Q9NQB0-8]
82129 [Q9NQB0-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31824, 477 antibodies from 34 providers

The DNASU plasmid repository

More...DNASUi		6934

Genome annotation databases

EnsembliENST00000352065; ENSP00000344823; ENSG00000148737 [Q9NQB0-12]
ENST00000355717; ENSP00000347949; ENSG00000148737 [Q9NQB0-11]
ENST00000355995; ENSP00000348274; ENSG00000148737
ENST00000369397; ENSP00000358404; ENSG00000148737 [Q9NQB0-8]
ENST00000538897; ENSP00000446172; ENSG00000148737 [Q9NQB0-6]
ENST00000627217; ENSP00000486891; ENSG00000148737 [Q9NQB0-7]
GeneIDi6934
KEGGihsa:6934
MANE-SelectiENST00000627217.3; ENSP00000486891.1; NM_001146274.2; NP_001139746.1 [Q9NQB0-7]
UCSCiuc001lac.5, human [Q9NQB0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6934
DisGeNETi6934

GeneCards: human genes, protein and diseases

More...GeneCardsi		TCF7L2
HGNCiHGNC:11641, TCF7L2
HPAiENSG00000148737, Tissue enriched (brain)
MalaCardsiTCF7L2
MIMi125853, phenotype
602228, gene
neXtProtiNX_Q9NQB0
OpenTargetsiENSG00000148737
PharmGKBiPA36394
VEuPathDBiHostDB:ENSG00000148737

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3248, Eukaryota
GeneTreeiENSGT00940000155535
HOGENOMiCLU_013229_5_0_1
InParanoidiQ9NQB0
OMAiSLPPITX
OrthoDBi807716at2759
PhylomeDBiQ9NQB0
TreeFamiTF318448

Enzyme and pathway databases

PathwayCommonsiQ9NQB0
ReactomeiR-HSA-201722, Formation of the beta-catenin:TCF transactivating complex
R-HSA-3769402, Deactivation of the beta-catenin transactivating complex
R-HSA-381771, Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
R-HSA-4086398, Ca2+ pathway
R-HSA-4411364, Binding of TCF/LEF:CTNNB1 to target gene promoters
R-HSA-4641265, Repression of WNT target genes
R-HSA-5339700, Signaling by TCF7L2 mutants
R-HSA-8853884, Transcriptional Regulation by VENTX
R-HSA-8951430, RUNX3 regulates WNT signaling
SignaLinkiQ9NQB0
SIGNORiQ9NQB0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		6934, 68 hits in 1064 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TCF7L2, human
EvolutionaryTraceiQ9NQB0

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TCF7L2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6934
PharosiQ9NQB0, Tbio

Protein Ontology

More...PROi		PR:Q9NQB0
RNActiQ9NQB0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000148737, Expressed in lateral nuclear group of thalamus and 242 other tissues
ExpressionAtlasiQ9NQB0, baseline and differential
GenevisibleiQ9NQB0, HS

Family and domain databases

DisProtiDP00175
Gene3Di1.10.30.10, 1 hit
4.10.900.10, 1 hit
IDEALiIID00100
InterProiView protein in InterPro
IPR027397, Catenin-bd_sf
IPR013558, CTNNB1-bd_N
IPR009071, HMG_box_dom
IPR036910, HMG_box_dom_sf
IPR024940, TCF/LEF
PANTHERiPTHR10373, PTHR10373, 1 hit
PfamiView protein in Pfam
PF08347, CTNNB1_binding, 1 hit
PF00505, HMG_box, 1 hit
SMARTiView protein in SMART
SM00398, HMG, 1 hit
SUPFAMiSSF47095, SSF47095, 1 hit
PROSITEiView protein in PROSITE
PS50118, HMG_BOX_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTF7L2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQB0
Secondary accession number(s): B4DRJ8
, B9X074, C6ZRJ8, C6ZRK0, E2GH14, E2GH19, E2GH20, E2GH24, E2GH25, E9PFH9, F8W742, F8W7T5, O00185, Q9NQB1, Q9NQB2, Q9NQB3, Q9NQB4, Q9NQB5, Q9NQB6, Q9NQB7, Q9ULC2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: March 25, 2003
Last modified: February 23, 2022
This is version 213 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again