Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (08 May 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

APOBEC1 complementation factor

Gene

A1CF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • mRNA binding Source: GO_Central
  • RNA binding Source: GO_Central
  • single-stranded RNA binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processmRNA processing

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-72200 mRNA Editing: C to U Conversion
R-HSA-75094 Formation of the Editosome

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
APOBEC1 complementation factor
Alternative name(s):
APOBEC1-stimulating protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:A1CF
Synonyms:ACF, ASPImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24086 A1CF

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618199 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NQ94

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi59F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi100F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi139F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi183F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi234Y → A: Slightly reduced RNA binding. 1 Publication1
Mutagenesisi270F → A: Slightly reduced RNA binding. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
29974

Open Targets

More...
OpenTargetsi
ENSG00000148584

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162375098

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
A1CF

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74761651

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000814821 – 594APOBEC1 complementation factorAdd BLAST594

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei499PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NQ94

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NQ94

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NQ94

PeptideAtlas

More...
PeptideAtlasi
Q9NQ94

PRoteomics IDEntifications database

More...
PRIDEi
Q9NQ94

ProteomicsDB human proteome resource

More...
ProteomicsDBi
82112
82113 [Q9NQ94-2]
82114 [Q9NQ94-3]
82115 [Q9NQ94-4]
82116 [Q9NQ94-5]
82117 [Q9NQ94-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NQ94

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NQ94

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in brain, liver, pancreas, colon and spleen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000148584 Expressed in 83 organ(s), highest expression level in liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NQ94 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NQ94 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037779
HPA044079

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the apolipoprotein B mRNA editing complex with APOBEC1. Interacts with TNPO2; TNPO2 may be responsible for transport of A1CF into the nucleus. Interacts with SYNCRIP. Interacts with CELF2/CUGBP2 (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119004, 11 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1097 C-to-U editosome complex

Protein interaction database and analysis system

More...
IntActi
Q9NQ94, 24 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000378868

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1594
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NQ94

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9NQ94

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini56 – 134RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini136 – 218RRM 2PROSITE-ProRule annotationAdd BLAST83
Domaini231 – 303RRM 3PROSITE-ProRule annotationAdd BLAST73

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni360 – 409Required for nuclear localization1 PublicationAdd BLAST50

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RRM domains are necessary but not sufficient for binding to APOB mRNA. Additional residues in the pre-RRM and C-terminal regions are required for RNA-binding and for complementing APOBEC1 activity.1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0117 Eukaryota
ENOG410XTJ5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158678

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NQ94

Database of Orthologous Groups

More...
OrthoDBi
1384330at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NQ94

TreeFam database of animal gene trees

More...
TreeFami
TF314932

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12486 RRM1_ACF, 1 hit
cd12498 RRM3_ACF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033111 A1CF
IPR034538 ACF_RRM1
IPR034539 ACF_RRM3
IPR006535 HnRNP_R/Q_splicing_fac
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

The PANTHER Classification System

More...
PANTHERi
PTHR21245:SF8 PTHR21245:SF8, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076 RRM_1, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 3 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01648 hnRNP-R-Q, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9NQ94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESNHKSGDG LSGTQKEAAL RALVQRTGYS LVQENGQRKY GGPPPGWDAA
60 70 80 90 100
PPERGCEIFI GKLPRDLFED ELIPLCEKIG KIYEMRMMMD FNGNNRGYAF
110 120 130 140 150
VTFSNKVEAK NAIKQLNNYE IRNGRLLGVC ASVDNCRLFV GGIPKTKKRE
160 170 180 190 200
EILSEMKKVT EGVVDVIVYP SAADKTKNRG FAFVEYESHR AAAMARRKLL
210 220 230 240 250
PGRIQLWGHG IAVDWAEPEV EVDEDTMSSV KILYVRNLML STSEEMIEKE
260 270 280 290 300
FNNIKPGAVE RVKKIRDYAF VHFSNREDAV EAMKALNGKV LDGSPIEVTL
310 320 330 340 350
AKPVDKDSYV RYTRGTGGRG TMLQGEYTYS LGQVYDPTTT YLGAPVFYAP
360 370 380 390 400
QTYAAIPSLH FPATKGHLSN RAIIRAPSVR EIYMNVPVGA AGVRGLGGRG
410 420 430 440 450
YLAYTGLGRG YQVKGDKRED KLYDILPGME LTPMNPVTLK PQGIKLAPQI
460 470 480 490 500
LEEICQKNNW GQPVYQLHSA IGQDQRQLFL YKITIPALAS QNPAIHPFTP
510 520 530 540 550
PKLSAFVDEA KTYAAEYTLQ TLGIPTDGGD GTMATAAAAA TAFPGYAVPN
560 570 580 590
ATAPVSAAQL KQAVTLGQDL AAYTTYEVYP TFAVTARGDG YGTF
Length:594
Mass (Da):65,202
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAA5EF76BD8815807
GO
Isoform 22 Publications (identifier: Q9NQ94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-388: Missing.

Note: Major isoform found in 66-78% of cDNA clones.1 Publication
Show »
Length:586
Mass (Da):64,256
Checksum:iA836BBA98FD1BD51
GO
Isoform 3 (identifier: Q9NQ94-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MLCSPSFCKLCWKRKK
     381-388: Missing.

Show »
Length:569
Mass (Da):62,682
Checksum:iF185421309CBA29F
GO
Isoform 4Curated (identifier: Q9NQ94-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEK
     381-388: Missing.

Note: Does not exhibit APOBEC1 complementation activity.Curated1 Publication
Show »
Length:594
Mass (Da):65,024
Checksum:i2F2C8897629F9E3C
GO
Isoform 51 Publication (identifier: Q9NQ94-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-84: Missing.

Note: Does not exhibit APOBEC1 complementation activity.1 Publication
Show »
Length:510
Mass (Da):55,962
Checksum:i70E050F5DB3F4DA2
GO
Isoform 61 Publication (identifier: Q9NQ94-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     202-256: Missing.

Note: Minor isoform found in 2-3% of cDNA clones.1 Publication
Show »
Length:539
Mass (Da):58,871
Checksum:i924E9C2A43A6788C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W9F8F8W9F8_HUMAN
APOBEC1 complementation factor
A1CF
602Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T0W7Q5T0W7_HUMAN
APOBEC1 complementation factor
A1CF
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91086 differs from that shown. Reason: Frameshift at position 148.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti191A → T in AAF34824 (PubMed:10669759).Curated1
Sequence conflicti277E → K (PubMed:10669759).Curated1
Sequence conflicti277E → K (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052201555V → M. Corresponds to variant dbSNP:rs9073Ensembl.1
Natural variantiVAR_059821558A → S. Corresponds to variant dbSNP:rs11817448Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0519251 – 84Missing in isoform 5. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_0519261 – 33MESNH…YSLVQ → MLCSPSFCKLCWKRKK in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0519271 – 33MESNH…YSLVQ → MEAVCLGTCPEPEASMSTAI PGLKKGNNALQSIILQTLLE K in isoform 4. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_051928202 – 256Missing in isoform 6. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_051929381 – 388Missing in isoform 2, isoform 3 and isoform 4. 5 Publications8

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ272078 mRNA Translation: CAB94754.1
AJ272079 mRNA Translation: CAB94755.1
AF209192 mRNA Translation: AAF34824.1
AF271789 mRNA Translation: AAF76221.1
AF271790 mRNA Translation: AAF76222.1
AK000324 mRNA Translation: BAA91086.1 Frameshift.
AK291982 mRNA Translation: BAF84671.1
AL512366 Genomic DNA No translation available.
AL589794 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54133.1
CH471083 Genomic DNA Translation: EAW54134.1
CH471083 Genomic DNA Translation: EAW54135.1
BC130519 mRNA Translation: AAI30520.1
BC144196 mRNA Translation: AAI44197.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7241.1 [Q9NQ94-2]
CCDS7242.1 [Q9NQ94-1]
CCDS7243.1 [Q9NQ94-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001185747.1, NM_001198818.1 [Q9NQ94-2]
NP_001185748.1, NM_001198819.1
NP_001185749.1, NM_001198820.1 [Q9NQ94-4]
NP_055391.2, NM_014576.3 [Q9NQ94-2]
NP_620310.1, NM_138932.2 [Q9NQ94-1]
NP_620311.1, NM_138933.2 [Q9NQ94-4]
XP_005269775.1, XM_005269718.2 [Q9NQ94-1]
XP_005269777.1, XM_005269720.3 [Q9NQ94-1]
XP_016871649.1, XM_017016160.1 [Q9NQ94-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000282641; ENSP00000282641; ENSG00000148584 [Q9NQ94-2]
ENST00000373993; ENSP00000363105; ENSG00000148584 [Q9NQ94-1]
ENST00000373995; ENSP00000363107; ENSG00000148584 [Q9NQ94-4]
ENST00000373997; ENSP00000363109; ENSG00000148584 [Q9NQ94-2]
ENST00000374001; ENSP00000363113; ENSG00000148584 [Q9NQ94-2]
ENST00000395495; ENSP00000378873; ENSG00000148584 [Q9NQ94-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29974

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29974

UCSC genome browser

More...
UCSCi
uc001jjh.4 human [Q9NQ94-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ272078 mRNA Translation: CAB94754.1
AJ272079 mRNA Translation: CAB94755.1
AF209192 mRNA Translation: AAF34824.1
AF271789 mRNA Translation: AAF76221.1
AF271790 mRNA Translation: AAF76222.1
AK000324 mRNA Translation: BAA91086.1 Frameshift.
AK291982 mRNA Translation: BAF84671.1
AL512366 Genomic DNA No translation available.
AL589794 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54133.1
CH471083 Genomic DNA Translation: EAW54134.1
CH471083 Genomic DNA Translation: EAW54135.1
BC130519 mRNA Translation: AAI30520.1
BC144196 mRNA Translation: AAI44197.1
CCDSiCCDS7241.1 [Q9NQ94-2]
CCDS7242.1 [Q9NQ94-1]
CCDS7243.1 [Q9NQ94-4]
RefSeqiNP_001185747.1, NM_001198818.1 [Q9NQ94-2]
NP_001185748.1, NM_001198819.1
NP_001185749.1, NM_001198820.1 [Q9NQ94-4]
NP_055391.2, NM_014576.3 [Q9NQ94-2]
NP_620310.1, NM_138932.2 [Q9NQ94-1]
NP_620311.1, NM_138933.2 [Q9NQ94-4]
XP_005269775.1, XM_005269718.2 [Q9NQ94-1]
XP_005269777.1, XM_005269720.3 [Q9NQ94-1]
XP_016871649.1, XM_017016160.1 [Q9NQ94-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CPDNMR-A223-308[»]
SMRiQ9NQ94
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119004, 11 interactors
ComplexPortaliCPX-1097 C-to-U editosome complex
IntActiQ9NQ94, 24 interactors
STRINGi9606.ENSP00000378868

PTM databases

iPTMnetiQ9NQ94
PhosphoSitePlusiQ9NQ94

Polymorphism and mutation databases

BioMutaiA1CF
DMDMi74761651

Proteomic databases

jPOSTiQ9NQ94
MaxQBiQ9NQ94
PaxDbiQ9NQ94
PeptideAtlasiQ9NQ94
PRIDEiQ9NQ94
ProteomicsDBi82112
82113 [Q9NQ94-2]
82114 [Q9NQ94-3]
82115 [Q9NQ94-4]
82116 [Q9NQ94-5]
82117 [Q9NQ94-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282641; ENSP00000282641; ENSG00000148584 [Q9NQ94-2]
ENST00000373993; ENSP00000363105; ENSG00000148584 [Q9NQ94-1]
ENST00000373995; ENSP00000363107; ENSG00000148584 [Q9NQ94-4]
ENST00000373997; ENSP00000363109; ENSG00000148584 [Q9NQ94-2]
ENST00000374001; ENSP00000363113; ENSG00000148584 [Q9NQ94-2]
ENST00000395495; ENSP00000378873; ENSG00000148584 [Q9NQ94-4]
GeneIDi29974
KEGGihsa:29974
UCSCiuc001jjh.4 human [Q9NQ94-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29974
DisGeNETi29974

GeneCards: human genes, protein and diseases

More...
GeneCardsi
A1CF
HGNCiHGNC:24086 A1CF
HPAiHPA037779
HPA044079
MIMi618199 gene
neXtProtiNX_Q9NQ94
OpenTargetsiENSG00000148584
PharmGKBiPA162375098

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0117 Eukaryota
ENOG410XTJ5 LUCA
GeneTreeiENSGT00940000158678
InParanoidiQ9NQ94
OrthoDBi1384330at2759
PhylomeDBiQ9NQ94
TreeFamiTF314932

Enzyme and pathway databases

ReactomeiR-HSA-72200 mRNA Editing: C to U Conversion
R-HSA-75094 Formation of the Editosome

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
A1CF human
EvolutionaryTraceiQ9NQ94

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ACF_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29974

Protein Ontology

More...
PROi
PR:Q9NQ94

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000148584 Expressed in 83 organ(s), highest expression level in liver
ExpressionAtlasiQ9NQ94 baseline and differential
GenevisibleiQ9NQ94 HS

Family and domain databases

CDDicd12486 RRM1_ACF, 1 hit
cd12498 RRM3_ACF, 1 hit
Gene3Di3.30.70.330, 3 hits
InterProiView protein in InterPro
IPR033111 A1CF
IPR034538 ACF_RRM1
IPR034539 ACF_RRM3
IPR006535 HnRNP_R/Q_splicing_fac
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PANTHERiPTHR21245:SF8 PTHR21245:SF8, 1 hit
PfamiView protein in Pfam
PF00076 RRM_1, 3 hits
SMARTiView protein in SMART
SM00360 RRM, 3 hits
SUPFAMiSSF54928 SSF54928, 3 hits
TIGRFAMsiTIGR01648 hnRNP-R-Q, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiA1CF_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQ94
Secondary accession number(s): A1L4F2
, A8K7G7, B7ZM14, Q5SZQ0, Q9NQ93, Q9NQX8, Q9NQX9, Q9NXC9, Q9NZD3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: October 1, 2000
Last modified: May 8, 2019
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again