Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

APOBEC1 complementation factor

Gene

A1CF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also protects the edited APOB mRNA from nonsense-mediated decay.3 Publications

GO - Molecular functioni

  • RNA binding Source: ProtInc
  • single-stranded RNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionRNA-binding
Biological processmRNA processing

Enzyme and pathway databases

ReactomeiR-HSA-72200 mRNA Editing: C to U Conversion
R-HSA-75094 Formation of the Editosome

Names & Taxonomyi

Protein namesi
Recommended name:
APOBEC1 complementation factor
Alternative name(s):
APOBEC1-stimulating protein
Gene namesi
Name:A1CF
Synonyms:ACF, ASPImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000148584.14
HGNCiHGNC:24086 A1CF
neXtProtiNX_Q9NQ94

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi59F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi100F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi139F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi183F → A: Greatly reduced RNA binding. 1 Publication1
Mutagenesisi234Y → A: Slightly reduced RNA binding. 1 Publication1
Mutagenesisi270F → A: Slightly reduced RNA binding. 1 Publication1

Organism-specific databases

DisGeNETi29974
OpenTargetsiENSG00000148584
PharmGKBiPA162375098

Polymorphism and mutation databases

BioMutaiA1CF
DMDMi74761651

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000814821 – 594APOBEC1 complementation factorAdd BLAST594

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei499PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9NQ94
PaxDbiQ9NQ94
PeptideAtlasiQ9NQ94
PRIDEiQ9NQ94
ProteomicsDBi82112
82113 [Q9NQ94-2]
82114 [Q9NQ94-3]
82115 [Q9NQ94-4]
82116 [Q9NQ94-5]
82117 [Q9NQ94-6]

PTM databases

iPTMnetiQ9NQ94
PhosphoSitePlusiQ9NQ94

Expressioni

Tissue specificityi

Widely expressed with highest levels in brain, liver, pancreas, colon and spleen.1 Publication

Gene expression databases

BgeeiENSG00000148584 Expressed in 83 organ(s), highest expression level in liver
CleanExiHS_A1CF
ExpressionAtlasiQ9NQ94 baseline and differential
GenevisibleiQ9NQ94 HS

Organism-specific databases

HPAiHPA037779
HPA044079

Interactioni

Subunit structurei

Part of the apolipoprotein B mRNA editing complex with APOBEC1. Interacts with TNPO2; TNPO2 may be responsible for transport of A1CF into the nucleus. Interacts with SYNCRIP. Interacts with CELF2/CUGBP2 (By similarity).By similarity

Binary interactionsi

Protein-protein interaction databases

BioGridi119004, 11 interactors
ComplexPortaliCPX-1097 C-to-U editosome complex
IntActiQ9NQ94, 24 interactors
STRINGi9606.ENSP00000282641

Structurei

Secondary structure

1594
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9NQ94
SMRiQ9NQ94
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NQ94

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini56 – 134RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini136 – 218RRM 2PROSITE-ProRule annotationAdd BLAST83
Domaini231 – 303RRM 3PROSITE-ProRule annotationAdd BLAST73

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni360 – 409Required for nuclear localization1 PublicationAdd BLAST50

Domaini

The RRM domains are necessary but not sufficient for binding to APOB mRNA. Additional residues in the pre-RRM and C-terminal regions are required for RNA-binding and for complementing APOBEC1 activity.1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0117 Eukaryota
ENOG410XTJ5 LUCA
GeneTreeiENSGT00550000074366
HOVERGENiHBG051917
InParanoidiQ9NQ94
PhylomeDBiQ9NQ94
TreeFamiTF314932

Family and domain databases

CDDicd12486 RRM1_ACF, 1 hit
cd12498 RRM3_ACF, 1 hit
Gene3Di3.30.70.330, 3 hits
InterProiView protein in InterPro
IPR033111 A1CF
IPR034538 ACF_RRM1
IPR034539 ACF_RRM3
IPR006535 HnRNP_R/Q_splicing_fac
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PANTHERiPTHR43980:SF2 PTHR43980:SF2, 1 hit
PfamiView protein in Pfam
PF00076 RRM_1, 3 hits
SMARTiView protein in SMART
SM00360 RRM, 3 hits
SUPFAMiSSF54928 SSF54928, 3 hits
TIGRFAMsiTIGR01648 hnRNP-R-Q, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 3 hits

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9NQ94-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESNHKSGDG LSGTQKEAAL RALVQRTGYS LVQENGQRKY GGPPPGWDAA
60 70 80 90 100
PPERGCEIFI GKLPRDLFED ELIPLCEKIG KIYEMRMMMD FNGNNRGYAF
110 120 130 140 150
VTFSNKVEAK NAIKQLNNYE IRNGRLLGVC ASVDNCRLFV GGIPKTKKRE
160 170 180 190 200
EILSEMKKVT EGVVDVIVYP SAADKTKNRG FAFVEYESHR AAAMARRKLL
210 220 230 240 250
PGRIQLWGHG IAVDWAEPEV EVDEDTMSSV KILYVRNLML STSEEMIEKE
260 270 280 290 300
FNNIKPGAVE RVKKIRDYAF VHFSNREDAV EAMKALNGKV LDGSPIEVTL
310 320 330 340 350
AKPVDKDSYV RYTRGTGGRG TMLQGEYTYS LGQVYDPTTT YLGAPVFYAP
360 370 380 390 400
QTYAAIPSLH FPATKGHLSN RAIIRAPSVR EIYMNVPVGA AGVRGLGGRG
410 420 430 440 450
YLAYTGLGRG YQVKGDKRED KLYDILPGME LTPMNPVTLK PQGIKLAPQI
460 470 480 490 500
LEEICQKNNW GQPVYQLHSA IGQDQRQLFL YKITIPALAS QNPAIHPFTP
510 520 530 540 550
PKLSAFVDEA KTYAAEYTLQ TLGIPTDGGD GTMATAAAAA TAFPGYAVPN
560 570 580 590
ATAPVSAAQL KQAVTLGQDL AAYTTYEVYP TFAVTARGDG YGTF
Length:594
Mass (Da):65,202
Last modified:October 1, 2000 - v1
Checksum:iAA5EF76BD8815807
GO
Isoform 22 Publications (identifier: Q9NQ94-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-388: Missing.

Note: Major isoform found in 66-78% of cDNA clones.1 Publication
Show »
Length:586
Mass (Da):64,256
Checksum:iA836BBA98FD1BD51
GO
Isoform 3 (identifier: Q9NQ94-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MLCSPSFCKLCWKRKK
     381-388: Missing.

Show »
Length:569
Mass (Da):62,682
Checksum:iF185421309CBA29F
GO
Isoform 4Curated (identifier: Q9NQ94-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQ → MEAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEK
     381-388: Missing.

Note: Does not exhibit APOBEC1 complementation activity.Curated1 Publication
Show »
Length:594
Mass (Da):65,024
Checksum:i2F2C8897629F9E3C
GO
Isoform 51 Publication (identifier: Q9NQ94-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-84: Missing.

Note: Does not exhibit APOBEC1 complementation activity.1 Publication
Show »
Length:510
Mass (Da):55,962
Checksum:i70E050F5DB3F4DA2
GO
Isoform 61 Publication (identifier: Q9NQ94-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     202-256: Missing.

Note: Minor isoform found in 2-3% of cDNA clones.1 Publication
Show »
Length:539
Mass (Da):58,871
Checksum:i924E9C2A43A6788C
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W9F8F8W9F8_HUMAN
APOBEC1 complementation factor
A1CF
602Annotation score:
Q5T0W7Q5T0W7_HUMAN
APOBEC1 complementation factor
A1CF
201Annotation score:

Sequence cautioni

The sequence BAA91086 differs from that shown. Reason: Frameshift at position 148.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti191A → T in AAF34824 (PubMed:10669759).Curated1
Sequence conflicti277E → K (PubMed:10669759).Curated1
Sequence conflicti277E → K (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_052201555V → M. Corresponds to variant dbSNP:rs9073Ensembl.1
Natural variantiVAR_059821558A → S. Corresponds to variant dbSNP:rs11817448Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0519251 – 84Missing in isoform 5. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_0519261 – 33MESNH…YSLVQ → MLCSPSFCKLCWKRKK in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_0519271 – 33MESNH…YSLVQ → MEAVCLGTCPEPEASMSTAI PGLKKGNNALQSIILQTLLE K in isoform 4. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_051928202 – 256Missing in isoform 6. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_051929381 – 388Missing in isoform 2, isoform 3 and isoform 4. 5 Publications8

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ272078 mRNA Translation: CAB94754.1
AJ272079 mRNA Translation: CAB94755.1
AF209192 mRNA Translation: AAF34824.1
AF271789 mRNA Translation: AAF76221.1
AF271790 mRNA Translation: AAF76222.1
AK000324 mRNA Translation: BAA91086.1 Frameshift.
AK291982 mRNA Translation: BAF84671.1
AL512366 Genomic DNA No translation available.
AL589794 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54133.1
CH471083 Genomic DNA Translation: EAW54134.1
CH471083 Genomic DNA Translation: EAW54135.1
BC130519 mRNA Translation: AAI30520.1
BC144196 mRNA Translation: AAI44197.1
CCDSiCCDS7241.1 [Q9NQ94-2]
CCDS7242.1 [Q9NQ94-1]
CCDS7243.1 [Q9NQ94-4]
RefSeqiNP_001185747.1, NM_001198818.1 [Q9NQ94-2]
NP_001185748.1, NM_001198819.1
NP_001185749.1, NM_001198820.1 [Q9NQ94-4]
NP_055391.2, NM_014576.3 [Q9NQ94-2]
NP_620310.1, NM_138932.2 [Q9NQ94-1]
NP_620311.1, NM_138933.2 [Q9NQ94-4]
XP_005269775.1, XM_005269718.2 [Q9NQ94-1]
XP_005269777.1, XM_005269720.3 [Q9NQ94-1]
XP_016871649.1, XM_017016160.1 [Q9NQ94-2]
UniGeneiHs.282795

Genome annotation databases

EnsembliENST00000282641; ENSP00000282641; ENSG00000148584 [Q9NQ94-2]
ENST00000373993; ENSP00000363105; ENSG00000148584 [Q9NQ94-1]
ENST00000373995; ENSP00000363107; ENSG00000148584 [Q9NQ94-4]
ENST00000373997; ENSP00000363109; ENSG00000148584 [Q9NQ94-2]
ENST00000374001; ENSP00000363113; ENSG00000148584 [Q9NQ94-2]
ENST00000395495; ENSP00000378873; ENSG00000148584 [Q9NQ94-4]
GeneIDi29974
KEGGihsa:29974
UCSCiuc001jjh.4 human [Q9NQ94-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ272078 mRNA Translation: CAB94754.1
AJ272079 mRNA Translation: CAB94755.1
AF209192 mRNA Translation: AAF34824.1
AF271789 mRNA Translation: AAF76221.1
AF271790 mRNA Translation: AAF76222.1
AK000324 mRNA Translation: BAA91086.1 Frameshift.
AK291982 mRNA Translation: BAF84671.1
AL512366 Genomic DNA No translation available.
AL589794 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54133.1
CH471083 Genomic DNA Translation: EAW54134.1
CH471083 Genomic DNA Translation: EAW54135.1
BC130519 mRNA Translation: AAI30520.1
BC144196 mRNA Translation: AAI44197.1
CCDSiCCDS7241.1 [Q9NQ94-2]
CCDS7242.1 [Q9NQ94-1]
CCDS7243.1 [Q9NQ94-4]
RefSeqiNP_001185747.1, NM_001198818.1 [Q9NQ94-2]
NP_001185748.1, NM_001198819.1
NP_001185749.1, NM_001198820.1 [Q9NQ94-4]
NP_055391.2, NM_014576.3 [Q9NQ94-2]
NP_620310.1, NM_138932.2 [Q9NQ94-1]
NP_620311.1, NM_138933.2 [Q9NQ94-4]
XP_005269775.1, XM_005269718.2 [Q9NQ94-1]
XP_005269777.1, XM_005269720.3 [Q9NQ94-1]
XP_016871649.1, XM_017016160.1 [Q9NQ94-2]
UniGeneiHs.282795

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CPDNMR-A223-308[»]
ProteinModelPortaliQ9NQ94
SMRiQ9NQ94
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119004, 11 interactors
ComplexPortaliCPX-1097 C-to-U editosome complex
IntActiQ9NQ94, 24 interactors
STRINGi9606.ENSP00000282641

PTM databases

iPTMnetiQ9NQ94
PhosphoSitePlusiQ9NQ94

Polymorphism and mutation databases

BioMutaiA1CF
DMDMi74761651

Proteomic databases

MaxQBiQ9NQ94
PaxDbiQ9NQ94
PeptideAtlasiQ9NQ94
PRIDEiQ9NQ94
ProteomicsDBi82112
82113 [Q9NQ94-2]
82114 [Q9NQ94-3]
82115 [Q9NQ94-4]
82116 [Q9NQ94-5]
82117 [Q9NQ94-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282641; ENSP00000282641; ENSG00000148584 [Q9NQ94-2]
ENST00000373993; ENSP00000363105; ENSG00000148584 [Q9NQ94-1]
ENST00000373995; ENSP00000363107; ENSG00000148584 [Q9NQ94-4]
ENST00000373997; ENSP00000363109; ENSG00000148584 [Q9NQ94-2]
ENST00000374001; ENSP00000363113; ENSG00000148584 [Q9NQ94-2]
ENST00000395495; ENSP00000378873; ENSG00000148584 [Q9NQ94-4]
GeneIDi29974
KEGGihsa:29974
UCSCiuc001jjh.4 human [Q9NQ94-1]

Organism-specific databases

CTDi29974
DisGeNETi29974
EuPathDBiHostDB:ENSG00000148584.14
GeneCardsiA1CF
HGNCiHGNC:24086 A1CF
HPAiHPA037779
HPA044079
neXtProtiNX_Q9NQ94
OpenTargetsiENSG00000148584
PharmGKBiPA162375098
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0117 Eukaryota
ENOG410XTJ5 LUCA
GeneTreeiENSGT00550000074366
HOVERGENiHBG051917
InParanoidiQ9NQ94
PhylomeDBiQ9NQ94
TreeFamiTF314932

Enzyme and pathway databases

ReactomeiR-HSA-72200 mRNA Editing: C to U Conversion
R-HSA-75094 Formation of the Editosome

Miscellaneous databases

ChiTaRSiA1CF human
EvolutionaryTraceiQ9NQ94
GeneWikiiACF_(gene)
GenomeRNAii29974
PROiPR:Q9NQ94

Gene expression databases

BgeeiENSG00000148584 Expressed in 83 organ(s), highest expression level in liver
CleanExiHS_A1CF
ExpressionAtlasiQ9NQ94 baseline and differential
GenevisibleiQ9NQ94 HS

Family and domain databases

CDDicd12486 RRM1_ACF, 1 hit
cd12498 RRM3_ACF, 1 hit
Gene3Di3.30.70.330, 3 hits
InterProiView protein in InterPro
IPR033111 A1CF
IPR034538 ACF_RRM1
IPR034539 ACF_RRM3
IPR006535 HnRNP_R/Q_splicing_fac
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PANTHERiPTHR43980:SF2 PTHR43980:SF2, 1 hit
PfamiView protein in Pfam
PF00076 RRM_1, 3 hits
SMARTiView protein in SMART
SM00360 RRM, 3 hits
SUPFAMiSSF54928 SSF54928, 3 hits
TIGRFAMsiTIGR01648 hnRNP-R-Q, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiA1CF_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ94
Secondary accession number(s): A1L4F2
, A8K7G7, B7ZM14, Q5SZQ0, Q9NQ93, Q9NQX8, Q9NQX9, Q9NXC9, Q9NZD3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: October 1, 2000
Last modified: October 10, 2018
This is version 158 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again