Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (12 Aug 2020)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Matrix extracellular phosphoglycoprotein

Gene

MEPE

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Promotes renal phosphate excretion and inhibits intestinal phosphate absorption (PubMed:14962809, PubMed:19005008). Promotes bone mineralization by osteoblasts and cartilage mineralization by chondrocytes (PubMed:18162525, PubMed:19998030, PubMed:22766095). Regulates the mineralization of the extracellular matrix of the craniofacial complex, such as teeth, bone and cartilage (By similarity). Promotes dental pulp stem cell proliferation and differentiation (PubMed:22341070).By similarity6 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processBiomineralization

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9NQ76

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-381426, Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-8957275, Post-translational protein phosphorylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Matrix extracellular phosphoglycoprotein1 Publication
Alternative name(s):
Osteoblast/osteocyte factor 45By similarity
Short name:
OF45By similarity
Osteoregulin1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MEPE
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000152595.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13361, MEPE

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605912, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NQ76

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56955

Open Targets

More...
OpenTargetsi
ENSG00000152595

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30755

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NQ76, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MEPE

Domain mapping of disease mutations (DMDM)

More...
DMDMi
33112396

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 17Sequence analysisAdd BLAST17
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002166818 – 525Matrix extracellular phosphoglycoproteinAdd BLAST508

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi477N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi478N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine residues in the ASARM motif (in vitro) by FAM20C; the phosphorylation is important for the inhibition of bone mineralization (PubMed:19998030, PubMed:22582013).2 Publications
Cleaved by CTSB/cathepsin B; the cleavage is blocked by metalloprotease PHEX.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NQ76

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NQ76

PeptideAtlas

More...
PeptideAtlasi
Q9NQ76

PRoteomics IDEntifications database

More...
PRIDEi
Q9NQ76

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
26838
82096 [Q9NQ76-1]
82097 [Q9NQ76-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q9NQ76, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NQ76

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NQ76

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed by osteoblasts (PubMed:10945470, PubMed:11414762, PubMed:15108058). Expressed by stem cells in dental pulp (PubMed:15153459). Expressed by mesenchymal cells in dental papilla and dental pulp (PubMed:18547474, PubMed:22341070). Expressed in teeth, specifically in decidious dentin (PubMed:20581062). Expressed in ondotoblasts (PubMed:12489176). Expressed in salivary glands (PubMed:15329369). Secreted from oncogenic hypophosphatemic tumors (PubMed:11414762).9 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000152595, Expressed in tibia and 45 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NQ76, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NQ76, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000152595, Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via the ASARM motif) with PHEX; the interaction is zinc-dependent.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121279, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NQ76, 14 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000416984

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NQ76, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni242 – 264Dentonin2 PublicationsAdd BLAST23
Regioni507 – 525ASARM motif; interaction with PHEX1 PublicationAdd BLAST19

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi247 – 249Cell attachment siteSequence analysis3

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The acidic serine aspartate-rich MEPE-associated (ASARM) motif is sufficient when phosphorylated to inhibit bone mineralization by osteoblasts and cartilage mineralization by chondrocytes by binding hydroxyapatite crystals during the mineralization stage (PubMed:15664000, PubMed:18162525, PubMed:18597632, PubMed:19998030, PubMed:22766095). It can also inhibit dentin mineralization (PubMed:20581062).6 Publications
The dentonin region is sufficient to promote dental pulp stem cell proliferation (PubMed:15153459). It can also stimulate bone formation, osteoblast differentiation, and activate integrin signaling pathways (PubMed:15040834).2 Publications

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PF07175/osteoregulin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502SW2S, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000010702

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_039303_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NQ76

Identification of Orthologs from Complete Genome Data

More...
OMAi
NHYVPHR

Database of Orthologous Groups

More...
OrthoDBi
962767at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NQ76

TreeFam database of animal gene trees

More...
TreeFami
TF338655

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009837, Osteoregulin

The PANTHER Classification System

More...
PANTHERi
PTHR16510, PTHR16510, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07175, Osteoregulin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NQ76-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRVFCVGLLL FSVTWAAPTF QPQTEKTKQS CVEEQRQEEK NKDNIGFHHL
60 70 80 90 100
GKRINQELSS KENIVQERKK DLSLSEASEN KGSSKSQNYF TNRQRLNKEY
110 120 130 140 150
SISNKENTHN GLRMSIYPKS TGNKGFEDGD DAISKLHDQE EYGAALIRNN
160 170 180 190 200
MQHIMGPVTA IKLLGEENKE NTPRNVLNII PASMNYAKAH SKDKKKPQRD
210 220 230 240 250
SQAQKSPVKS KSTHRIQHNI DYLKHLSKVK KIPSDFEGSG YTDLQERGDN
260 270 280 290 300
DISPFSGDGQ PFKDIPGKGE ATGPDLEGKD IQTGFAGPSE AESTHLDTKK
310 320 330 340 350
PGYNEIPERE ENGGNTIGTR DETAKEADAV DVSLVEGSND IMGSTNFKEL
360 370 380 390 400
PGREGNRVDA GSQNAHQGKV EFHYPPAPSK EKRKEGSSDA AESTNYNEIP
410 420 430 440 450
KNGKGSTRKG VDHSNRNQAT LNEKQRFPSK GKSQGLPIPS RGLDNEIKNE
460 470 480 490 500
MDSFNGPSHE NIITHGRKYH YVPHRQNNST RNKGMPQGKG SWGRQPHSNR
510 520
RFSSRRRDDS SESSDSGSSS ESDGD
Length:525
Mass (Da):58,419
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0977CA6E871CA9E5
GO
Isoform 2 (identifier: Q9NQ76-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-36: R → RITYKGHYEKHGHYVFKCVYMSPEKKNQTDVK

Show »
Length:556
Mass (Da):62,160
Checksum:iF475015A4923DA71
GO
Isoform 3 (identifier: Q9NQ76-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: Missing.

Show »
Length:412
Mass (Da):45,291
Checksum:iB93BA6DAFF1D5052
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RFW6D6RFW6_HUMAN
Matrix extracellular phosphoglycopr...
MEPE
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAC8D6RAC8_HUMAN
Matrix extracellular phosphoglycopr...
MEPE
501Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034094330V → I. Corresponds to variant dbSNP:rs17013285EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0468921 – 113Missing in isoform 3. CuratedAdd BLAST113
Alternative sequenceiVSP_04398636R → RITYKGHYEKHGHYVFKCVY MSPEKKNQTDVK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ276396 mRNA Translation: CAB97250.1
AF325916 mRNA Translation: AAK70343.1
AC093768 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06001.1
CH471057 Genomic DNA Translation: EAX06002.1
BC128158 mRNA Translation: AAI28159.1
DQ854717 mRNA Translation: ABI64294.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3625.1 [Q9NQ76-1]
CCDS54776.1 [Q9NQ76-3]
CCDS77940.1 [Q9NQ76-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001171623.1, NM_001184694.2 [Q9NQ76-1]
NP_001171624.1, NM_001184695.1 [Q9NQ76-3]
NP_001171625.1, NM_001184696.1 [Q9NQ76-3]
NP_001171626.1, NM_001184697.1 [Q9NQ76-3]
NP_001278112.1, NM_001291183.1 [Q9NQ76-2]
NP_064588.1, NM_020203.3 [Q9NQ76-1]
XP_006714341.1, XM_006714278.2 [Q9NQ76-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000361056; ENSP00000354341; ENSG00000152595 [Q9NQ76-1]
ENST00000395102; ENSP00000378534; ENSG00000152595 [Q9NQ76-2]
ENST00000424957; ENSP00000416984; ENSG00000152595 [Q9NQ76-1]
ENST00000540395; ENSP00000443491; ENSG00000152595 [Q9NQ76-3]
ENST00000560249; ENSP00000453994; ENSG00000152595 [Q9NQ76-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56955

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56955

UCSC genome browser

More...
UCSCi
uc003hqy.4, human [Q9NQ76-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ276396 mRNA Translation: CAB97250.1
AF325916 mRNA Translation: AAK70343.1
AC093768 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06001.1
CH471057 Genomic DNA Translation: EAX06002.1
BC128158 mRNA Translation: AAI28159.1
DQ854717 mRNA Translation: ABI64294.1
CCDSiCCDS3625.1 [Q9NQ76-1]
CCDS54776.1 [Q9NQ76-3]
CCDS77940.1 [Q9NQ76-2]
RefSeqiNP_001171623.1, NM_001184694.2 [Q9NQ76-1]
NP_001171624.1, NM_001184695.1 [Q9NQ76-3]
NP_001171625.1, NM_001184696.1 [Q9NQ76-3]
NP_001171626.1, NM_001184697.1 [Q9NQ76-3]
NP_001278112.1, NM_001291183.1 [Q9NQ76-2]
NP_064588.1, NM_020203.3 [Q9NQ76-1]
XP_006714341.1, XM_006714278.2 [Q9NQ76-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi121279, 4 interactors
IntActiQ9NQ76, 14 interactors
STRINGi9606.ENSP00000416984

PTM databases

GlyGeniQ9NQ76, 2 sites
iPTMnetiQ9NQ76
PhosphoSitePlusiQ9NQ76

Polymorphism and mutation databases

BioMutaiMEPE
DMDMi33112396

Proteomic databases

MassIVEiQ9NQ76
PaxDbiQ9NQ76
PeptideAtlasiQ9NQ76
PRIDEiQ9NQ76
ProteomicsDBi26838
82096 [Q9NQ76-1]
82097 [Q9NQ76-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
44860, 167 antibodies

Genome annotation databases

EnsembliENST00000361056; ENSP00000354341; ENSG00000152595 [Q9NQ76-1]
ENST00000395102; ENSP00000378534; ENSG00000152595 [Q9NQ76-2]
ENST00000424957; ENSP00000416984; ENSG00000152595 [Q9NQ76-1]
ENST00000540395; ENSP00000443491; ENSG00000152595 [Q9NQ76-3]
ENST00000560249; ENSP00000453994; ENSG00000152595 [Q9NQ76-3]
GeneIDi56955
KEGGihsa:56955
UCSCiuc003hqy.4, human [Q9NQ76-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56955
DisGeNETi56955
EuPathDBiHostDB:ENSG00000152595.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MEPE
HGNCiHGNC:13361, MEPE
HPAiENSG00000152595, Tissue enriched (brain)
MIMi605912, gene
neXtProtiNX_Q9NQ76
OpenTargetsiENSG00000152595
PharmGKBiPA30755

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502SW2S, Eukaryota
GeneTreeiENSGT00390000010702
HOGENOMiCLU_039303_0_0_1
InParanoidiQ9NQ76
OMAiNHYVPHR
OrthoDBi962767at2759
PhylomeDBiQ9NQ76
TreeFamiTF338655

Enzyme and pathway databases

PathwayCommonsiQ9NQ76
ReactomeiR-HSA-381426, Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
R-HSA-8957275, Post-translational protein phosphorylation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
56955, 18 hits in 861 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MEPE

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56955
PharosiQ9NQ76, Tbio

Protein Ontology

More...
PROi
PR:Q9NQ76
RNActiQ9NQ76, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000152595, Expressed in tibia and 45 other tissues
ExpressionAtlasiQ9NQ76, baseline and differential
GenevisibleiQ9NQ76, HS

Family and domain databases

InterProiView protein in InterPro
IPR009837, Osteoregulin
PANTHERiPTHR16510, PTHR16510, 1 hit
PfamiView protein in Pfam
PF07175, Osteoregulin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMEPE_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQ76
Secondary accession number(s): A1A4X9
, A8MTA3, D2CFR4, F5H5C5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: October 1, 2000
Last modified: August 12, 2020
This is version 131 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again