Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9NQ66 (PLCB1_HUMAN)

Entry version 206 (07 Apr 2021)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Add a publicationFeedback
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

Gene

PLCB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the hydrolysis of 1-phosphatidylinositol 4,5-bisphosphate into diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) and mediates intracellular signaling downstream of G protein-coupled receptors (PubMed:9188725). Regulates the function of the endothelial barrier.By similarity1 Publication

Miscellaneous

The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Ca2+

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei331PROSITE-ProRule annotation1
Active sitei378PROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS11935-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.1.4.11, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9NQ66

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-112043, PLC beta mediated events
R-HSA-1855204, Synthesis of IP3 and IP4 in the cytosol
R-HSA-399997, Acetylcholine regulates insulin secretion
R-HSA-4086398, Ca2+ pathway
R-HSA-416476, G alpha (q) signalling events
R-HSA-418217, G beta:gamma signalling through PLC beta
R-HSA-434316, Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion
R-HSA-500657, Presynaptic function of Kainate receptors

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9NQ66

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9NQ66

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000000662

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1Curated (EC:3.1.4.111 Publication)
Alternative name(s):
PLC-154
Phosphoinositide phospholipase C-beta-1
Phospholipase C-I
Short name:
PLC-I
Phospholipase C-beta-1
Short name:
PLC-beta-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLCB1Imported
Synonyms:KIAA0581
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:15917, PLCB1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607120, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9NQ66

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000182621.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Developmental and epileptic encephalopathy 12 (DEE12)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of epilepsy characterized by frequent tonic seizures or spasms beginning in infancy with a specific EEG finding of suppression-burst patterns, characterized by high-voltage bursts alternating with almost flat suppression phases. Patients may progress to West syndrome, which is characterized by tonic spasms with clustering, arrest of psychomotor development, and hypsarrhythmia on EEG.
Related information in OMIM

Keywords - Diseasei

Epilepsy

Organism-specific databases

DisGeNET

More...DisGeNETi		23236

MalaCards human disease database

More...MalaCardsi		PLCB1
MIMi613722, phenotype

Open Targets

More...OpenTargetsi		ENSG00000182621

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		293181, Malignant migrating focal seizures of infancy
3451, West syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA33384

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9NQ66, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4034

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PLCB1

Domain mapping of disease mutations (DMDM)

More...DMDMi		12643814

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000884861 – 12161-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1Add BLAST1216

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi17S-palmitoyl cysteineBy similarity1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei236PhosphoserineBy similarity1
Modified residuei417PhosphoserineBy similarity1
Modified residuei509PhosphothreonineBy similarity1
Modified residuei511PhosphoserineBy similarity1
Modified residuei582PhosphoserineBy similarity1
Modified residuei887Phosphoserine; by PKCBy similarity1
Modified residuei978PhosphoserineBy similarity1
Modified residuei987PhosphoserineBy similarity1
Modified residuei1199PhosphoserineBy similarity1
Modified residuei1200PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated. Palmitoylation at Cys-17 by ZDHHC21 regulates the signaling activity of PLCB1 and the function of the endothelial barrier. Palmitoylation by ZDHHC21 is stimulated by inflammation.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9NQ66

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9NQ66

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9NQ66

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9NQ66

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9NQ66

PeptideAtlas

More...PeptideAtlasi		Q9NQ66

PRoteomics IDEntifications database

More...PRIDEi		Q9NQ66

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		82087 [Q9NQ66-1]
82088 [Q9NQ66-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9NQ66

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9NQ66

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q9NQ66

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000182621, Expressed in endothelial cell and 230 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9NQ66, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9NQ66, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000182621, Tissue enhanced (parathyroid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DGKQ.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116841, 32 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9NQ66

Protein interaction database and analysis system

More...IntActi		Q9NQ66, 14 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000338185

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9NQ66

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9NQ66, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9NQ66

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini316 – 467PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST152
Domaini540 – 656PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST117
Domaini656 – 786C2PROSITE-ProRule annotationAdd BLAST131

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1265, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155428

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9NQ66

Identification of Orthologs from Complete Genome Data

More...OMAi		RDIAQIW

Database of Orthologous Groups

More...OrthoDBi		368239at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9NQ66

TreeFam database of animal gene trees

More...TreeFami		TF313216

Family and domain databases

Conserved Domains Database

More...CDDi		cd13361, PH_PLC_beta, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.1230.10, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR011992, EF-hand-dom_pair
IPR001192, PI-PLC_fam
IPR016280, PLC-beta
IPR028400, PLC-beta1
IPR014815, PLC-beta_C
IPR042531, PLC-beta_C_sf
IPR009535, PLC-beta_CS
IPR037862, PLC-beta_PH
IPR017946, PLC-like_Pdiesterase_TIM-brl
IPR015359, PLC_EF-hand-like
IPR000909, PLipase_C_PInositol-sp_X_dom
IPR001711, PLipase_C_Pinositol-sp_Y

The PANTHER Classification System

More...PANTHERi		PTHR10336, PTHR10336, 1 hit
PTHR10336:SF12, PTHR10336:SF12, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF06631, DUF1154, 1 hit
PF09279, EF-hand_like, 1 hit
PF17787, PH_14, 1 hit
PF00388, PI-PLC-X, 1 hit
PF00387, PI-PLC-Y, 1 hit
PF08703, PLC-beta_C, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF000956, PLC-beta, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00390, PHPHLIPASEC

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00239, C2, 1 hit
SM00148, PLCXc, 1 hit
SM00149, PLCYc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473, SSF47473, 1 hit
SSF51695, SSF51695, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50004, C2, 1 hit
PS50007, PIPLC_X_DOMAIN, 1 hit
PS50008, PIPLC_Y_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 18 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q9NQ66-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGAQPGVHA LQLKPVCVSD SLKKGTKFVK WDDDSTIVTP IILRTDPQGF 
        60         70         80         90        100
FFYWTDQNKE TELLDLSLVK DARCGRHAKA PKDPKLRELL DVGNIGRLEQ 
       110        120        130        140        150
RMITVVYGPD LVNISHLNLV AFQEEVAKEW TNEVFSLATN LLAQNMSRDA 
       160        170        180        190        200
FLEKAYTKLK LQVTPEGRIP LKNIYRLFSA DRKRVETALE ACSLPSSRND 
       210        220        230        240        250
SIPQEDFTPE VYRVFLNNLC PRPEIDNIFS EFGAKSKPYL TVDQMMDFIN 
       260        270        280        290        300
LKQRDPRLNE ILYPPLKQEQ VQVLIEKYEP NNSLARKGQI SVDGFMRYLS 
       310        320        330        340        350
GEENGVVSPE KLDLNEDMSQ PLSHYFINSS HNTYLTAGQL AGNSSVEMYR 
       360        370        380        390        400
QVLLSGCRCV ELDCWKGRTA EEEPVITHGF TMTTEISFKE VIEAIAECAF 
       410        420        430        440        450
KTSPFPILLS FENHVDSPKQ QAKMAEYCRL IFGDALLMEP LEKYPLESGV 
       460        470        480        490        500
PLPSPMDLMY KILVKNKKKS HKSSEGSGKK KLSEQASNTY SDSSSMFEPS 
       510        520        530        540        550
SPGAGEADTE SDDDDDDDDC KKSSMDEGTA GSEAMATEEM SNLVNYIQPV 
       560        570        580        590        600
KFESFEISKK RNKSFEMSSF VETKGLEQLT KSPVEFVEYN KMQLSRIYPK 
       610        620        630        640        650
GTRVDSSNYM PQLFWNAGCQ MVALNFQTMD LAMQINMGMY EYNGKSGYRL 
       660        670        680        690        700
KPEFMRRPDK HFDPFTEGIV DGIVANTLSV KIISGQFLSD KKVGTYVEVD 
       710        720        730        740        750
MFGLPVDTRR KAFKTKTSQG NAVNPVWEEE PIVFKKVVLP TLACLRIAVY 
       760        770        780        790        800
EEGGKFIGHR ILPVQAIRPG YHYICLRNER NQPLTLPAVF VYIEVKDYVP 
       810        820        830        840        850
DTYADVIEAL SNPIRYVNLM EQRAKQLAAL TLEDEEEVKK EADPGETPSE 
       860        870        880        890        900
APSEARTTPA ENGVNHTTTL TPKPPSQALH SQPAPGSVKA PAKTEDLIQS 
       910        920        930        940        950
VLTEVEAQTI EELKQQKSFV KLQKKHYKEM KDLVKRHHKK TTDLIKEHTT 
       960        970        980        990       1000
KYNEIQNDYL RRRAALEKSA KKDSKKKSEP SSPDHGSSTI EQDLAALDAE 
      1010       1020       1030       1040       1050
MTQKLIDLKD KQQQQLLNLR QEQYYSEKYQ KREHIKLLIQ KLTDVAEECQ 
      1060       1070       1080       1090       1100
NNQLKKLKEI CEKEKKELKK KMDKKRQEKI TEAKSKDKSQ MEEEKTEMIR 
      1110       1120       1130       1140       1150
SYIQEVVQYI KRLEEAQSKR QEKLVEKHKE IRQQILDEKP KLQVELEQEY 
      1160       1170       1180       1190       1200
QDKFKRLPLE ILEFVQEAMK GKISEDSNHG SAPLSLSSDP GKVNHKTPSS 
      1210 
EELGGDIPGK EFDTPL
Length:1,216
Mass (Da):138,567
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6F4263D1A50C6FD1
GO
Isoform B (identifier: Q9NQ66-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1142-1216: LQVELEQEYQ...IPGKEFDTPL → GEGSSSFLSETCHEDPSVSPNFTPPNPQALKW

Show »
Length:1,173
Mass (Da):133,703
Checksum:iB9DA88251A5769FB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 18 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WT80A0A087WT80_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB1
1,136Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WW73A0A087WW73_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB1
1,093Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GWB6A0A1B0GWB6_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB1
1,072Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCJ2H0YCJ2_HUMAN
Phosphoinositide phospholipase C
PLCB1
914Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SF51A0A0D9SF51_HUMAN
Phosphoinositide phospholipase C
PLCB1
960Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SG17A0A0D9SG17_HUMAN
Phosphoinositide phospholipase C
PLCB1
961Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SGI7A0A0D9SGI7_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB1
231Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GW62A0A1B0GW62_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB1
199Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8IV92Q8IV92_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB1
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AK73B1AK73_HUMAN
1-phosphatidylinositol 4,5-bisphosp...
PLCB1
205Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA25507 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAB14641 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1 – 34MAGAQ…KWDDD → MGSLQGIATKILIRILSDAL IRKETDLKS in AAF86613 (PubMed:10760467).CuratedAdd BLAST34
Sequence conflicti189L → M in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti203P → L in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti216L → F in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti221P → L in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti266L → P in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti309P → T in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti320Q → R in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti352V → A in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti366K → R in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti393E → K in AAF86613 (PubMed:10760467).Curated1
Sequence conflicti983P → S in CAB98143 (PubMed:11118617).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050541854E → K. Corresponds to variant dbSNP:rs2076413Ensembl.1
Natural variantiVAR_036547907A → P in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0047181142 – 1216LQVEL…FDTPL → GEGSSSFLSETCHEDPSVSP NFTPPNPQALKW in isoform B. 4 PublicationsAdd BLAST75

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ278313 mRNA Translation: CAB98142.1
AJ278314 mRNA Translation: CAB98143.1
AY004175 mRNA Translation: AAF86613.1
AB011153 mRNA Translation: BAA25507.3 Different initiation.
AL031683 Genomic DNA No translation available.
AL034551 Genomic DNA No translation available.
AL049593 Genomic DNA No translation available.
AL049632 Genomic DNA No translation available.
AL050315 Genomic DNA No translation available.
AL050323 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10372.1
CH471133 Genomic DNA Translation: EAX10373.1
CH471133 Genomic DNA Translation: EAX10374.1
CH471133 Genomic DNA Translation: EAX10376.1
BC069420 mRNA Translation: AAH69420.1
BC117231 mRNA Translation: AAI17232.1
AL137267 mRNA Translation: CAB70666.1
AK023689 mRNA Translation: BAB14641.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13102.1 [Q9NQ66-1]
CCDS13103.1 [Q9NQ66-2]

NCBI Reference Sequences

More...RefSeqi		NP_056007.1, NM_015192.3 [Q9NQ66-1]
NP_877398.1, NM_182734.2 [Q9NQ66-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000338037; ENSP00000338185; ENSG00000182621 [Q9NQ66-1]
ENST00000378637; ENSP00000367904; ENSG00000182621 [Q9NQ66-2]
ENST00000378641; ENSP00000367908; ENSG00000182621 [Q9NQ66-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		23236

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:23236

UCSC genome browser

More...UCSCi		uc002wna.5, human [Q9NQ66-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278313 mRNA Translation: CAB98142.1
AJ278314 mRNA Translation: CAB98143.1
AY004175 mRNA Translation: AAF86613.1
AB011153 mRNA Translation: BAA25507.3 Different initiation.
AL031683 Genomic DNA No translation available.
AL034551 Genomic DNA No translation available.
AL049593 Genomic DNA No translation available.
AL049632 Genomic DNA No translation available.
AL050315 Genomic DNA No translation available.
AL050323 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10372.1
CH471133 Genomic DNA Translation: EAX10373.1
CH471133 Genomic DNA Translation: EAX10374.1
CH471133 Genomic DNA Translation: EAX10376.1
BC069420 mRNA Translation: AAH69420.1
BC117231 mRNA Translation: AAI17232.1
AL137267 mRNA Translation: CAB70666.1
AK023689 mRNA Translation: BAB14641.1 Different initiation.
CCDSiCCDS13102.1 [Q9NQ66-1]
CCDS13103.1 [Q9NQ66-2]
RefSeqiNP_056007.1, NM_015192.3 [Q9NQ66-1]
NP_877398.1, NM_182734.2 [Q9NQ66-2]

3D structure databases

SMRiQ9NQ66
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116841, 32 interactors
CORUMiQ9NQ66
IntActiQ9NQ66, 14 interactors
STRINGi9606.ENSP00000338185

Chemistry databases

BindingDBiQ9NQ66
ChEMBLiCHEMBL4034
SwissLipidsiSLP:000000662

PTM databases

iPTMnetiQ9NQ66
PhosphoSitePlusiQ9NQ66
SwissPalmiQ9NQ66

Genetic variation databases

BioMutaiPLCB1
DMDMi12643814

Proteomic databases

EPDiQ9NQ66
jPOSTiQ9NQ66
MassIVEiQ9NQ66
MaxQBiQ9NQ66
PaxDbiQ9NQ66
PeptideAtlasiQ9NQ66
PRIDEiQ9NQ66
ProteomicsDBi82087 [Q9NQ66-1]
82088 [Q9NQ66-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3795, 267 antibodies

Genome annotation databases

EnsembliENST00000338037; ENSP00000338185; ENSG00000182621 [Q9NQ66-1]
ENST00000378637; ENSP00000367904; ENSG00000182621 [Q9NQ66-2]
ENST00000378641; ENSP00000367908; ENSG00000182621 [Q9NQ66-2]
GeneIDi23236
KEGGihsa:23236
UCSCiuc002wna.5, human [Q9NQ66-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23236
DisGeNETi23236

GeneCards: human genes, protein and diseases

More...GeneCardsi		PLCB1
HGNCiHGNC:15917, PLCB1
HPAiENSG00000182621, Tissue enhanced (parathyroid)
MalaCardsiPLCB1
MIMi607120, gene
613722, phenotype
neXtProtiNX_Q9NQ66
OpenTargetsiENSG00000182621
Orphaneti293181, Malignant migrating focal seizures of infancy
3451, West syndrome
PharmGKBiPA33384
VEuPathDBiHostDB:ENSG00000182621.16

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1265, Eukaryota
GeneTreeiENSGT00940000155428
InParanoidiQ9NQ66
OMAiRDIAQIW
OrthoDBi368239at2759
PhylomeDBiQ9NQ66
TreeFamiTF313216

Enzyme and pathway databases

BioCyciMetaCyc:HS11935-MONOMER
BRENDAi3.1.4.11, 2681
PathwayCommonsiQ9NQ66
ReactomeiR-HSA-112043, PLC beta mediated events
R-HSA-1855204, Synthesis of IP3 and IP4 in the cytosol
R-HSA-399997, Acetylcholine regulates insulin secretion
R-HSA-4086398, Ca2+ pathway
R-HSA-416476, G alpha (q) signalling events
R-HSA-418217, G beta:gamma signalling through PLC beta
R-HSA-434316, Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion
R-HSA-500657, Presynaptic function of Kainate receptors
SignaLinkiQ9NQ66
SIGNORiQ9NQ66

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		23236, 10 hits in 998 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PLCB1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PLCB1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		23236
PharosiQ9NQ66, Tbio

Protein Ontology

More...PROi		PR:Q9NQ66
RNActiQ9NQ66, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000182621, Expressed in endothelial cell and 230 other tissues
ExpressionAtlasiQ9NQ66, baseline and differential
GenevisibleiQ9NQ66, HS

Family and domain databases

CDDicd13361, PH_PLC_beta, 1 hit
Gene3Di1.20.1230.10, 1 hit
2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008, C2_dom
IPR035892, C2_domain_sf
IPR011992, EF-hand-dom_pair
IPR001192, PI-PLC_fam
IPR016280, PLC-beta
IPR028400, PLC-beta1
IPR014815, PLC-beta_C
IPR042531, PLC-beta_C_sf
IPR009535, PLC-beta_CS
IPR037862, PLC-beta_PH
IPR017946, PLC-like_Pdiesterase_TIM-brl
IPR015359, PLC_EF-hand-like
IPR000909, PLipase_C_PInositol-sp_X_dom
IPR001711, PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336, PTHR10336, 1 hit
PTHR10336:SF12, PTHR10336:SF12, 1 hit
PfamiView protein in Pfam
PF06631, DUF1154, 1 hit
PF09279, EF-hand_like, 1 hit
PF17787, PH_14, 1 hit
PF00388, PI-PLC-X, 1 hit
PF00387, PI-PLC-Y, 1 hit
PF08703, PLC-beta_C, 1 hit
PIRSFiPIRSF000956, PLC-beta, 1 hit
PRINTSiPR00390, PHPHLIPASEC
SMARTiView protein in SMART
SM00239, C2, 1 hit
SM00148, PLCXc, 1 hit
SM00149, PLCYc, 1 hit
SUPFAMiSSF47473, SSF47473, 1 hit
SSF51695, SSF51695, 1 hit
PROSITEiView protein in PROSITE
PS50004, C2, 1 hit
PS50007, PIPLC_X_DOMAIN, 1 hit
PS50008, PIPLC_Y_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLCB1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQ66
Secondary accession number(s): D3DW12
, D3DW13, O60325, Q17RQ6, Q5TFF7, Q5TGC9, Q8IV93, Q9BQW2, Q9H4H2, Q9H8H5, Q9NQ65, Q9NQH9, Q9NTH4, Q9UJP6, Q9UM26
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: October 1, 2000
Last modified: April 7, 2021
This is version 206 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again