Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Equatorin

Gene

EQTN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Acrosomal membrane-anchored protein involved in the process of fertilization and in acrosome biogenesis.By similarity

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Equatorin
Alternative name(s):
Acrosome formation-associated factor
Gene namesi
Name:EQTN
Synonyms:AFAF, C9orf11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000120160.10
HGNCiHGNC:1359 EQTN
MIMi617653 gene
neXtProtiNX_Q9NQ60

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini15 – 181VesicularSequence analysisAdd BLAST167
Transmembranei182 – 202HelicalSequence analysisAdd BLAST21
Topological domaini203 – 294CytoplasmicSequence analysisAdd BLAST92

Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi54586
OpenTargetsiENSG00000120160
PharmGKBiPA25969

Polymorphism and mutation databases

BioMutaiEQTN
DMDMi147742918

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 14Sequence analysisAdd BLAST14
ChainiPRO_000028659315 – 294EquatorinAdd BLAST280

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi76N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

Highly N- and O-glycosylated; contains sialic acid.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9NQ60
PeptideAtlasiQ9NQ60
PRIDEiQ9NQ60
ProteomicsDBi82084
82085 [Q9NQ60-2]
82086 [Q9NQ60-3]

PTM databases

iPTMnetiQ9NQ60
PhosphoSitePlusiQ9NQ60

Expressioni

Tissue specificityi

Isoform 1 is highly expressed in testis. Isoform 2 is expressed at low levels in skin and blood.1 Publication

Gene expression databases

BgeeiENSG00000120160 Expressed in 74 organ(s), highest expression level in sperm
CleanExiHS_C9orf11
GenevisibleiQ9NQ60 HS

Organism-specific databases

HPAiHPA015089
HPA015504

Interactioni

Subunit structurei

Interacts with SNAP25.By similarity

Protein-protein interaction databases

STRINGi9606.ENSP00000369371

Structurei

3D structure databases

ProteinModelPortaliQ9NQ60
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IX0T Eukaryota
ENOG4111AZ5 LUCA
GeneTreeiENSGT00390000010786
HOGENOMiHOG000033836
HOVERGENiHBG106628
InParanoidiQ9NQ60
KOiK19920
OMAiPSHKNIQ
OrthoDBiEOG091G0OWH
PhylomeDBiQ9NQ60
TreeFamiTF337449

Family and domain databases

InterProiView protein in InterPro
IPR029282 Eqtn/Afaf
PANTHERiPTHR36874 PTHR36874, 1 hit
PfamiView protein in Pfam
PF15339 Afaf, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NQ60-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFILFIFIP GVFSLKSSTL KPTIEALPNV LPLNEDVNKQ EEKNEDHTPN
60 70 80 90 100
YAPANEKNGN YYKDIKQYVF TTQNPNGTES EISVRATTDL NFALKNDKTV
110 120 130 140 150
NATTYEKSTI EEETTTSEPS HKNIQRSTPN VPAFWTMLAK AINGTAVVMD
160 170 180 190 200
DKDQLFHPIP ESDVNATQGE NQPDLEDLKI KIMLGISLMT LLLFVVLLAF
210 220 230 240 250
CSATLYKLRH LSYKSCESQY SVNPELATMS YFHPSEGVSD TSFSKSAESS
260 270 280 290
TFLGTTSSDM RRSGTRTSES KIMTDIISIG SDNEMHENDE SVTR
Length:294
Mass (Da):32,840
Last modified:May 15, 2007 - v2
Checksum:i0EEB8BD5F22F4063
GO
Isoform 2 (identifier: Q9NQ60-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-127: RS → SI
     128-294: Missing.

Show »
Length:127
Mass (Da):14,360
Checksum:i55DB058714124EDB
GO
Isoform 3 (identifier: Q9NQ60-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-126: DKTVNATTYEKSTIEEETTTSEPSHKNIQR → G

Show »
Length:265
Mass (Da):29,476
Checksum:iA723653FC5307981
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti282D → N in CAC00687 (PubMed:11118625).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032136101N → D. Corresponds to variant dbSNP:rs12337286Ensembl.1
Natural variantiVAR_056727110I → T. Corresponds to variant dbSNP:rs12341576Ensembl.1
Natural variantiVAR_032137274T → K1 PublicationCorresponds to variant dbSNP:rs41305329Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04215797 – 126DKTVN…KNIQR → G in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_025109126 – 127RS → SI in isoform 2. 1 Publication2
Alternative sequenceiVSP_025110128 – 294Missing in isoform 2. 1 PublicationAdd BLAST167

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278482 mRNA Translation: CAC00687.1
AL133411 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58566.1
BC014307 mRNA Translation: AAH14307.1
BC137351 mRNA Translation: AAI37352.1
BC137352 mRNA Translation: AAI37353.1
BC144602 mRNA Translation: AAI44603.1
CCDSiCCDS35001.1 [Q9NQ60-1]
CCDS55300.1 [Q9NQ60-3]
RefSeqiNP_001155057.1, NM_001161585.1 [Q9NQ60-3]
NP_065692.2, NM_020641.2 [Q9NQ60-1]
UniGeneiHs.163070

Genome annotation databases

EnsembliENST00000380031; ENSP00000369370; ENSG00000120160 [Q9NQ60-2]
ENST00000380032; ENSP00000369371; ENSG00000120160 [Q9NQ60-1]
ENST00000537675; ENSP00000441630; ENSG00000120160 [Q9NQ60-3]
GeneIDi54586
KEGGihsa:54586
UCSCiuc003zql.4 human [Q9NQ60-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278482 mRNA Translation: CAC00687.1
AL133411 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58566.1
BC014307 mRNA Translation: AAH14307.1
BC137351 mRNA Translation: AAI37352.1
BC137352 mRNA Translation: AAI37353.1
BC144602 mRNA Translation: AAI44603.1
CCDSiCCDS35001.1 [Q9NQ60-1]
CCDS55300.1 [Q9NQ60-3]
RefSeqiNP_001155057.1, NM_001161585.1 [Q9NQ60-3]
NP_065692.2, NM_020641.2 [Q9NQ60-1]
UniGeneiHs.163070

3D structure databases

ProteinModelPortaliQ9NQ60
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000369371

PTM databases

iPTMnetiQ9NQ60
PhosphoSitePlusiQ9NQ60

Polymorphism and mutation databases

BioMutaiEQTN
DMDMi147742918

Proteomic databases

PaxDbiQ9NQ60
PeptideAtlasiQ9NQ60
PRIDEiQ9NQ60
ProteomicsDBi82084
82085 [Q9NQ60-2]
82086 [Q9NQ60-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380031; ENSP00000369370; ENSG00000120160 [Q9NQ60-2]
ENST00000380032; ENSP00000369371; ENSG00000120160 [Q9NQ60-1]
ENST00000537675; ENSP00000441630; ENSG00000120160 [Q9NQ60-3]
GeneIDi54586
KEGGihsa:54586
UCSCiuc003zql.4 human [Q9NQ60-1]

Organism-specific databases

CTDi54586
DisGeNETi54586
EuPathDBiHostDB:ENSG00000120160.10
GeneCardsiEQTN
H-InvDBiHIX0007962
HGNCiHGNC:1359 EQTN
HPAiHPA015089
HPA015504
MIMi617653 gene
neXtProtiNX_Q9NQ60
OpenTargetsiENSG00000120160
PharmGKBiPA25969
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IX0T Eukaryota
ENOG4111AZ5 LUCA
GeneTreeiENSGT00390000010786
HOGENOMiHOG000033836
HOVERGENiHBG106628
InParanoidiQ9NQ60
KOiK19920
OMAiPSHKNIQ
OrthoDBiEOG091G0OWH
PhylomeDBiQ9NQ60
TreeFamiTF337449

Miscellaneous databases

ChiTaRSiEQTN human
GenomeRNAii54586
PROiPR:Q9NQ60
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000120160 Expressed in 74 organ(s), highest expression level in sperm
CleanExiHS_C9orf11
GenevisibleiQ9NQ60 HS

Family and domain databases

InterProiView protein in InterPro
IPR029282 Eqtn/Afaf
PANTHERiPTHR36874 PTHR36874, 1 hit
PfamiView protein in Pfam
PF15339 Afaf, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiEQTN_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ60
Secondary accession number(s): B2RPB3
, B7ZMK1, Q5TCU1, Q96L22
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: November 7, 2018
This is version 108 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again