Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 110 (13 Feb 2019)
Sequence version 2 (15 May 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Equatorin

Gene

EQTN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acrosomal membrane-anchored protein involved in the process of fertilization and in acrosome biogenesis.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Equatorin
Alternative name(s):
Acrosome formation-associated factor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EQTN
Synonyms:AFAF, C9orf11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000120160.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1359 EQTN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617653 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NQ60

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini15 – 181VesicularSequence analysisAdd BLAST167
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei182 – 202HelicalSequence analysisAdd BLAST21
Topological domaini203 – 294CytoplasmicSequence analysisAdd BLAST92

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
54586

Open Targets

More...
OpenTargetsi
ENSG00000120160

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25969

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EQTN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
147742918

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 14Sequence analysisAdd BLAST14
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000028659315 – 294EquatorinAdd BLAST280

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi76N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi143N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Highly N- and O-glycosylated; contains sialic acid.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NQ60

PeptideAtlas

More...
PeptideAtlasi
Q9NQ60

PRoteomics IDEntifications database

More...
PRIDEi
Q9NQ60

ProteomicsDB human proteome resource

More...
ProteomicsDBi
82084
82085 [Q9NQ60-2]
82086 [Q9NQ60-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NQ60

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NQ60

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is highly expressed in testis. Isoform 2 is expressed at low levels in skin and blood.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000120160 Expressed in 74 organ(s), highest expression level in sperm

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NQ60 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA015089
HPA015504

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SNAP25.By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369371

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9NQ60

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IX0T Eukaryota
ENOG4111AZ5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000010786

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000033836

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106628

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NQ60

KEGG Orthology (KO)

More...
KOi
K19920

Identification of Orthologs from Complete Genome Data

More...
OMAi
PSHKNIQ

Database of Orthologous Groups

More...
OrthoDBi
1090314at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NQ60

TreeFam database of animal gene trees

More...
TreeFami
TF337449

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029282 Eqtn/Afaf

The PANTHER Classification System

More...
PANTHERi
PTHR36874 PTHR36874, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15339 Afaf, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NQ60-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFILFIFIP GVFSLKSSTL KPTIEALPNV LPLNEDVNKQ EEKNEDHTPN
60 70 80 90 100
YAPANEKNGN YYKDIKQYVF TTQNPNGTES EISVRATTDL NFALKNDKTV
110 120 130 140 150
NATTYEKSTI EEETTTSEPS HKNIQRSTPN VPAFWTMLAK AINGTAVVMD
160 170 180 190 200
DKDQLFHPIP ESDVNATQGE NQPDLEDLKI KIMLGISLMT LLLFVVLLAF
210 220 230 240 250
CSATLYKLRH LSYKSCESQY SVNPELATMS YFHPSEGVSD TSFSKSAESS
260 270 280 290
TFLGTTSSDM RRSGTRTSES KIMTDIISIG SDNEMHENDE SVTR
Length:294
Mass (Da):32,840
Last modified:May 15, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0EEB8BD5F22F4063
GO
Isoform 2 (identifier: Q9NQ60-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     126-127: RS → SI
     128-294: Missing.

Show »
Length:127
Mass (Da):14,360
Checksum:i55DB058714124EDB
GO
Isoform 3 (identifier: Q9NQ60-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     97-126: DKTVNATTYEKSTIEEETTTSEPSHKNIQR → G

Show »
Length:265
Mass (Da):29,476
Checksum:iA723653FC5307981
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti282D → N in CAC00687 (PubMed:11118625).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032136101N → D. Corresponds to variant dbSNP:rs12337286Ensembl.1
Natural variantiVAR_056727110I → T. Corresponds to variant dbSNP:rs12341576Ensembl.1
Natural variantiVAR_032137274T → K1 PublicationCorresponds to variant dbSNP:rs41305329Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04215797 – 126DKTVN…KNIQR → G in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_025109126 – 127RS → SI in isoform 2. 1 Publication2
Alternative sequenceiVSP_025110128 – 294Missing in isoform 2. 1 PublicationAdd BLAST167

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ278482 mRNA Translation: CAC00687.1
AL133411 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58566.1
BC014307 mRNA Translation: AAH14307.1
BC137351 mRNA Translation: AAI37352.1
BC137352 mRNA Translation: AAI37353.1
BC144602 mRNA Translation: AAI44603.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35001.1 [Q9NQ60-1]
CCDS55300.1 [Q9NQ60-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001155057.1, NM_001161585.1 [Q9NQ60-3]
NP_065692.2, NM_020641.2 [Q9NQ60-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.163070

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000380031; ENSP00000369370; ENSG00000120160 [Q9NQ60-2]
ENST00000380032; ENSP00000369371; ENSG00000120160 [Q9NQ60-1]
ENST00000537675; ENSP00000441630; ENSG00000120160 [Q9NQ60-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54586

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54586

UCSC genome browser

More...
UCSCi
uc003zql.4 human [Q9NQ60-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278482 mRNA Translation: CAC00687.1
AL133411 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58566.1
BC014307 mRNA Translation: AAH14307.1
BC137351 mRNA Translation: AAI37352.1
BC137352 mRNA Translation: AAI37353.1
BC144602 mRNA Translation: AAI44603.1
CCDSiCCDS35001.1 [Q9NQ60-1]
CCDS55300.1 [Q9NQ60-3]
RefSeqiNP_001155057.1, NM_001161585.1 [Q9NQ60-3]
NP_065692.2, NM_020641.2 [Q9NQ60-1]
UniGeneiHs.163070

3D structure databases

ProteinModelPortaliQ9NQ60
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000369371

PTM databases

iPTMnetiQ9NQ60
PhosphoSitePlusiQ9NQ60

Polymorphism and mutation databases

BioMutaiEQTN
DMDMi147742918

Proteomic databases

PaxDbiQ9NQ60
PeptideAtlasiQ9NQ60
PRIDEiQ9NQ60
ProteomicsDBi82084
82085 [Q9NQ60-2]
82086 [Q9NQ60-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380031; ENSP00000369370; ENSG00000120160 [Q9NQ60-2]
ENST00000380032; ENSP00000369371; ENSG00000120160 [Q9NQ60-1]
ENST00000537675; ENSP00000441630; ENSG00000120160 [Q9NQ60-3]
GeneIDi54586
KEGGihsa:54586
UCSCiuc003zql.4 human [Q9NQ60-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54586
DisGeNETi54586
EuPathDBiHostDB:ENSG00000120160.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EQTN

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0007962
HGNCiHGNC:1359 EQTN
HPAiHPA015089
HPA015504
MIMi617653 gene
neXtProtiNX_Q9NQ60
OpenTargetsiENSG00000120160
PharmGKBiPA25969

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IX0T Eukaryota
ENOG4111AZ5 LUCA
GeneTreeiENSGT00390000010786
HOGENOMiHOG000033836
HOVERGENiHBG106628
InParanoidiQ9NQ60
KOiK19920
OMAiPSHKNIQ
OrthoDBi1090314at2759
PhylomeDBiQ9NQ60
TreeFamiTF337449

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
EQTN human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54586

Protein Ontology

More...
PROi
PR:Q9NQ60

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000120160 Expressed in 74 organ(s), highest expression level in sperm
GenevisibleiQ9NQ60 HS

Family and domain databases

InterProiView protein in InterPro
IPR029282 Eqtn/Afaf
PANTHERiPTHR36874 PTHR36874, 1 hit
PfamiView protein in Pfam
PF15339 Afaf, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEQTN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQ60
Secondary accession number(s): B2RPB3
, B7ZMK1, Q5TCU1, Q96L22
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: February 13, 2019
This is version 110 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again