Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine protease inhibitor Kazal-type 5

Gene

SPINK5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Serine protease inhibitor, probably important for the anti-inflammatory and/or antimicrobial protection of mucous epithelia. Contribute to the integrity and protective barrier function of the skin by regulating the activity of defense-activating and desquamation-involved proteases. Inhibits KLK5, it's major target, in a pH-dependent manner. Inhibits KLK7, KLK14 CASP14, and trypsin.3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei46 – 47Reactive bondPROSITE-ProRule annotation2

GO - Molecular functioni

  • serine-type endopeptidase inhibitor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionProtease inhibitor, Serine protease inhibitor

Enzyme and pathway databases

ReactomeiR-HSA-6809371 Formation of the cornified envelope
SABIO-RKiQ9NQ38

Protein family/group databases

MEROPSiI01.013

Names & Taxonomyi

Protein namesi
Recommended name:
Serine protease inhibitor Kazal-type 5
Alternative name(s):
Lympho-epithelial Kazal-type-related inhibitor
Short name:
LEKTI
Cleaved into the following 2 chains:
Gene namesi
Name:SPINK5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000133710.15
HGNCiHGNC:15464 SPINK5
MIMi605010 gene
neXtProtiNX_Q9NQ38

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

Netherton syndrome (NETH)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive congenital ichthyosis associated with hair shaft abnormalities and anomalies of the immune system. Typical features are ichthyosis linearis circumflexa, ichthyosiform erythroderma, trichorrhexis invaginata (bamboo hair), atopic dermatitis, and hayfever. High postnatal mortality is due to failure to thrive, infections and hypernatremic dehydration.
See also OMIM:256500

Keywords - Diseasei

Hypotrichosis, Ichthyosis

Organism-specific databases

DisGeNETi11005
MalaCardsiSPINK5
MIMi256500 phenotype
OpenTargetsiENSG00000133710
Orphaneti634 Netherton syndrome
PharmGKBiPA37962

Polymorphism and mutation databases

BioMutaiSPINK5
DMDMi212276440

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000001657223 – 1064Serine protease inhibitor Kazal-type 5Add BLAST1042
PeptideiPRO_000001657323 – 77Hemofiltrate peptide HF6478Add BLAST55
PeptideiPRO_0000016574356 – 423Hemofiltrate peptide HF7665Add BLAST68

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi30 ↔ 66
Disulfide bondi44 ↔ 63
Disulfide bondi97 ↔ 133PROSITE-ProRule annotation
Disulfide bondi111 ↔ 130PROSITE-ProRule annotation
Disulfide bondi119 ↔ 151PROSITE-ProRule annotation
Disulfide bondi161 ↔ 197PROSITE-ProRule annotation
Disulfide bondi175 ↔ 194PROSITE-ProRule annotation
Disulfide bondi225 ↔ 261PROSITE-ProRule annotation
Disulfide bondi239 ↔ 258PROSITE-ProRule annotation
Disulfide bondi297 ↔ 333PROSITE-ProRule annotation
Disulfide bondi311 ↔ 330PROSITE-ProRule annotation
Disulfide bondi367 ↔ 403
Disulfide bondi381 ↔ 400
Disulfide bondi437 ↔ 473PROSITE-ProRule annotation
Disulfide bondi451 ↔ 470PROSITE-ProRule annotation
Disulfide bondi496 ↔ 532PROSITE-ProRule annotation
Disulfide bondi510 ↔ 529PROSITE-ProRule annotation
Disulfide bondi567 ↔ 603PROSITE-ProRule annotation
Disulfide bondi581 ↔ 600PROSITE-ProRule annotation
Disulfide bondi632 ↔ 668PROSITE-ProRule annotation
Disulfide bondi646 ↔ 665PROSITE-ProRule annotation
Disulfide bondi707 ↔ 743PROSITE-ProRule annotation
Disulfide bondi721 ↔ 740PROSITE-ProRule annotation
Disulfide bondi774 ↔ 810PROSITE-ProRule annotation
Disulfide bondi788 ↔ 807PROSITE-ProRule annotation
Disulfide bondi849 ↔ 885PROSITE-ProRule annotation
Disulfide bondi863 ↔ 882PROSITE-ProRule annotation
Disulfide bondi916 ↔ 952PROSITE-ProRule annotation
Disulfide bondi930 ↔ 949PROSITE-ProRule annotation
Disulfide bondi993 ↔ 1028
Disulfide bondi1006 ↔ 1025
Disulfide bondi1014 ↔ 1046

Post-translational modificationi

Proteolytically processed by furin in individual domains (D1, D5, D6, D8 through D11, and D9 through D15) exhibiting various inhibitory potentials for multiple proteases.1 Publication

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond

Proteomic databases

PaxDbiQ9NQ38
PeptideAtlasiQ9NQ38
PRIDEiQ9NQ38
ProteomicsDBi82074
82075 [Q9NQ38-2]
82076 [Q9NQ38-3]

PTM databases

iPTMnetiQ9NQ38
PhosphoSitePlusiQ9NQ38

Miscellaneous databases

PMAP-CutDBiQ9NQ38

Expressioni

Tissue specificityi

Highly expressed in the thymus and stratum corneum. Also found in the oral mucosa, parathyroid gland, Bartholin's glands, tonsils, and vaginal epithelium. Very low levels are detected in lung, kidney, and prostate.1 Publication

Gene expression databases

BgeeiENSG00000133710 Expressed in 130 organ(s), highest expression level in mouth mucosa
CleanExiHS_SPINK5
ExpressionAtlasiQ9NQ38 baseline and differential
GenevisibleiQ9NQ38 HS

Organism-specific databases

HPAiCAB015347
HPA009067
HPA011351

Interactioni

Protein-protein interaction databases

BioGridi116196, 2 interactors
STRINGi9606.ENSP00000352936

Structurei

Secondary structure

11064
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9NQ38
SMRiQ9NQ38
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NQ38

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini28 – 66Kazal-like 1; atypicalPROSITE-ProRule annotationAdd BLAST39
Domaini91 – 153Kazal-like 2PROSITE-ProRule annotationAdd BLAST63
Domaini155 – 216Kazal-like 3PROSITE-ProRule annotationAdd BLAST62
Domaini219 – 285Kazal-like 4PROSITE-ProRule annotationAdd BLAST67
Domaini291 – 352Kazal-like 5PROSITE-ProRule annotationAdd BLAST62
Domaini361 – 423Kazal-like 6PROSITE-ProRule annotationAdd BLAST63
Domaini431 – 489Kazal-like 7PROSITE-ProRule annotationAdd BLAST59
Domaini490 – 551Kazal-like 8PROSITE-ProRule annotationAdd BLAST62
Domaini561 – 622Kazal-like 9PROSITE-ProRule annotationAdd BLAST62
Domaini626 – 688Kazal-like 10PROSITE-ProRule annotationAdd BLAST63
Domaini701 – 757Kazal-like 11PROSITE-ProRule annotationAdd BLAST57
Domaini768 – 830Kazal-like 12PROSITE-ProRule annotationAdd BLAST63
Domaini843 – 905Kazal-like 13PROSITE-ProRule annotationAdd BLAST63
Domaini910 – 971Kazal-like 14PROSITE-ProRule annotationAdd BLAST62
Domaini987 – 1048Kazal-like 15PROSITE-ProRule annotationAdd BLAST62

Domaini

Contains at least one active inhibitory domain for trypsin (domain 6).

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IP0D Eukaryota
ENOG4111TR7 LUCA
GeneTreeiENSGT00510000048608
HOVERGENiHBG006183
InParanoidiQ9NQ38
OMAiMHVNKCA
OrthoDBiEOG091G14HG
PhylomeDBiQ9NQ38
TreeFamiTF336724

Family and domain databases

InterProiView protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
PfamiView protein in Pfam
PF00050 Kazal_1, 11 hits
SMARTiView protein in SMART
SM00280 KAZAL, 14 hits
SUPFAMiSSF100895 SSF100895, 15 hits
PROSITEiView protein in PROSITE
PS00282 KAZAL_1, 2 hits
PS51465 KAZAL_2, 14 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform f-l (identifier: Q9NQ38-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKIATVSVLL PLALCLIQDA ASKNEDQEMC HEFQAFMKNG KLFCPQDKKF
60 70 80 90 100
FQSLDGIMFI NKCATCKMIL EKEAKSQKRA RHLARAPKAT APTELNCDDF
110 120 130 140 150
KKGERDGDFI CPDYYEAVCG TDGKTYDNRC ALCAENAKTG SQIGVKSEGE
160 170 180 190 200
CKSSNPEQDV CSAFRPFVRD GRLGCTREND PVLGPDGKTH GNKCAMCAEL
210 220 230 240 250
FLKEAENAKR EGETRIRRNA EKDFCKEYEK QVRNGRLFCT RESDPVRGPD
260 270 280 290 300
GRMHGNKCAL CAEIFKQRFS EENSKTDQNL GKAEEKTKVK REIVKLCSQY
310 320 330 340 350
QNQAKNGILF CTRENDPIRG PDGKMHGNLC SMCQAYFQAE NEEKKKAEAR
360 370 380 390 400
ARNKRESGKA TSYAELCSEY RKLVRNGKLA CTRENDPIQG PDGKVHGNTC
410 420 430 440 450
SMCEVFFQAE EEEKKKKEGK SRNKRQSKST ASFEELCSEY RKSRKNGRLF
460 470 480 490 500
CTRENDPIQG PDGKMHGNTC SMCEAFFQQE ERARAKAKRE AAKEICSEFR
510 520 530 540 550
DQVRNGTLIC TREHNPVRGP DGKMHGNKCA MCASVFKLEE EEKKNDKEEK
560 570 580 590 600
GKVEAEKVKR EAVQELCSEY RHYVRNGRLP CTRENDPIEG LDGKIHGNTC
610 620 630 640 650
SMCEAFFQQE AKEKERAEPR AKVKREAEKE TCDEFRRLLQ NGKLFCTREN
660 670 680 690 700
DPVRGPDGKT HGNKCAMCKA VFQKENEERK RKEEEDQRNA AGHGSSGGGG
710 720 730 740 750
GNTQDECAEY REQMKNGRLS CTRESDPVRD ADGKSYNNQC TMCKAKLERE
760 770 780 790 800
AERKNEYSRS RSNGTGSESG KDTCDEFRSQ MKNGKLICTR ESDPVRGPDG
810 820 830 840 850
KTHGNKCTMC KEKLEREAAE KKKKEDEDRS NTGERSNTGE RSNDKEDLCR
860 870 880 890 900
EFRSMQRNGK LICTRENNPV RGPYGKMHIN KCAMCQSIFD REANERKKKD
910 920 930 940 950
EEKSSSKPSN NAKDECSEFR NYIRNNELIC PRENDPVHGA DGKFYTNKCY
960 970 980 990 1000
MCRAVFLTEA LERAKLQEKP SHVRASQEED SPDSFSSLDS EMCKDYRVLP
1010 1020 1030 1040 1050
RIGYLCPKDL KPVCGDDGQT YNNPCMLCHE NLIRQTNTHI RSTGKCEESS
1060
TPGTTAASMP PSDE
Length:1,064
Mass (Da):120,714
Last modified:November 4, 2008 - v2
Checksum:i6CBEF39BB9E6D75D
GO
Isoform short (identifier: Q9NQ38-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     914-916: DEC → VIY
     917-1064: Missing.

Show »
Length:916
Mass (Da):104,017
Checksum:i82A029D102BD8C26
GO
Isoform long (identifier: Q9NQ38-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     914-914: D → DQCRQVQNEAEDAKFRQPGRSLASVARMSTD

Show »
Length:1,094
Mass (Da):124,076
Checksum:i8EF0D8DE3A62227A
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EWP9E7EWP9_HUMAN
Serine protease inhibitor Kazal-typ...
SPINK5
869Annotation score:
E5RFU9E5RFU9_HUMAN
Serine protease inhibitor Kazal-typ...
SPINK5
201Annotation score:
E5RG22E5RG22_HUMAN
Serine protease inhibitor Kazal-typ...
SPINK5
68Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti19 – 27DAASKNEDQ → GQCEKDSLS in CAB96877 (PubMed:10835624).Curated9

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_047115267Q → R3 PublicationsCorresponds to variant dbSNP:rs6892205EnsemblClinVar.1
Natural variantiVAR_061337335A → V2 PublicationsCorresponds to variant dbSNP:rs34482796EnsemblClinVar.1
Natural variantiVAR_047116368S → N3 PublicationsCorresponds to variant dbSNP:rs2303063EnsemblClinVar.1
Natural variantiVAR_047117386D → N. Corresponds to variant dbSNP:rs2303064EnsemblClinVar.1
Natural variantiVAR_047118395V → M. Corresponds to variant dbSNP:rs17775319Ensembl.1
Natural variantiVAR_015537420K → E3 PublicationsCorresponds to variant dbSNP:rs2303067EnsemblClinVar.1
Natural variantiVAR_047119441R → H. Corresponds to variant dbSNP:rs34393923EnsemblClinVar.1
Natural variantiVAR_047120588I → M. Corresponds to variant dbSNP:rs35877540EnsemblClinVar.1
Natural variantiVAR_047121711R → Q2 PublicationsCorresponds to variant dbSNP:rs3777134EnsemblClinVar.1
Natural variantiVAR_047122825E → D. Corresponds to variant dbSNP:rs2303070EnsemblClinVar.1
Natural variantiVAR_047123887S → R. Corresponds to variant dbSNP:rs28408445EnsemblClinVar.1
Natural variantiVAR_047124969K → E. Corresponds to variant dbSNP:rs3188691EnsemblClinVar.1
Natural variantiVAR_047125972H → R. Corresponds to variant dbSNP:rs17705005EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040019914 – 916DEC → VIY in isoform short. 1 Publication3
Alternative sequenceiVSP_040020914D → DQCRQVQNEAEDAKFRQPGR SLASVARMSTD in isoform long. 1 Publication1
Alternative sequenceiVSP_040021917 – 1064Missing in isoform short. 1 PublicationAdd BLAST148

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ228139 mRNA Translation: CAB40839.1
AJ391230
, AJ270944, AJ391231, AJ391232, AJ391233, AJ391234, AJ391235, AJ276579, AJ391236, AJ276580, AJ391237, AJ391238, AJ391239, AJ391240, AJ391241, AJ276578, AJ391242, AJ391243, AJ391244, AJ391245, AJ391246, AJ391247, AJ391248, AJ391249, AJ391250, AJ391251, AJ391252, AJ391253, AJ391254, AJ276577 Genomic DNA Translation: CAB96877.1
DQ149927 mRNA Translation: ABA06534.1
DQ149928 mRNA Translation: ABA06535.1
DQ149929 mRNA Translation: ABA06536.1
AC008722 Genomic DNA No translation available.
AC116334 Genomic DNA No translation available.
AF295784 Genomic DNA Translation: AAK97139.1
AF295783 Genomic DNA Translation: AAK97140.1
CCDSiCCDS43382.1 [Q9NQ38-1]
CCDS47300.1 [Q9NQ38-3]
CCDS47301.1 [Q9NQ38-2]
RefSeqiNP_001121170.1, NM_001127698.1 [Q9NQ38-3]
NP_001121171.1, NM_001127699.1 [Q9NQ38-2]
NP_006837.2, NM_006846.3 [Q9NQ38-1]
UniGeneiHs.331555

Genome annotation databases

EnsembliENST00000256084; ENSP00000256084; ENSG00000133710 [Q9NQ38-1]
ENST00000359874; ENSP00000352936; ENSG00000133710 [Q9NQ38-3]
ENST00000398454; ENSP00000381472; ENSG00000133710 [Q9NQ38-2]
GeneIDi11005
KEGGihsa:11005
UCSCiuc003low.2 human [Q9NQ38-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

SPINK5base

SPINK5 mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ228139 mRNA Translation: CAB40839.1
AJ391230
, AJ270944, AJ391231, AJ391232, AJ391233, AJ391234, AJ391235, AJ276579, AJ391236, AJ276580, AJ391237, AJ391238, AJ391239, AJ391240, AJ391241, AJ276578, AJ391242, AJ391243, AJ391244, AJ391245, AJ391246, AJ391247, AJ391248, AJ391249, AJ391250, AJ391251, AJ391252, AJ391253, AJ391254, AJ276577 Genomic DNA Translation: CAB96877.1
DQ149927 mRNA Translation: ABA06534.1
DQ149928 mRNA Translation: ABA06535.1
DQ149929 mRNA Translation: ABA06536.1
AC008722 Genomic DNA No translation available.
AC116334 Genomic DNA No translation available.
AF295784 Genomic DNA Translation: AAK97139.1
AF295783 Genomic DNA Translation: AAK97140.1
CCDSiCCDS43382.1 [Q9NQ38-1]
CCDS47300.1 [Q9NQ38-3]
CCDS47301.1 [Q9NQ38-2]
RefSeqiNP_001121170.1, NM_001127698.1 [Q9NQ38-3]
NP_001121171.1, NM_001127699.1 [Q9NQ38-2]
NP_006837.2, NM_006846.3 [Q9NQ38-1]
UniGeneiHs.331555

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1H0ZNMR-A356-423[»]
1HDLNMR-A23-77[»]
1UUCNMR-A23-77[»]
1UVFNMR-A989-1047[»]
1UVGNMR-A989-1064[»]
ProteinModelPortaliQ9NQ38
SMRiQ9NQ38
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116196, 2 interactors
STRINGi9606.ENSP00000352936

Protein family/group databases

MEROPSiI01.013

PTM databases

iPTMnetiQ9NQ38
PhosphoSitePlusiQ9NQ38

Polymorphism and mutation databases

BioMutaiSPINK5
DMDMi212276440

Proteomic databases

PaxDbiQ9NQ38
PeptideAtlasiQ9NQ38
PRIDEiQ9NQ38
ProteomicsDBi82074
82075 [Q9NQ38-2]
82076 [Q9NQ38-3]

Protocols and materials databases

DNASUi11005
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000256084; ENSP00000256084; ENSG00000133710 [Q9NQ38-1]
ENST00000359874; ENSP00000352936; ENSG00000133710 [Q9NQ38-3]
ENST00000398454; ENSP00000381472; ENSG00000133710 [Q9NQ38-2]
GeneIDi11005
KEGGihsa:11005
UCSCiuc003low.2 human [Q9NQ38-1]

Organism-specific databases

CTDi11005
DisGeNETi11005
EuPathDBiHostDB:ENSG00000133710.15
GeneCardsiSPINK5
H-InvDBiHIX0005288
HGNCiHGNC:15464 SPINK5
HPAiCAB015347
HPA009067
HPA011351
MalaCardsiSPINK5
MIMi256500 phenotype
605010 gene
neXtProtiNX_Q9NQ38
OpenTargetsiENSG00000133710
Orphaneti634 Netherton syndrome
PharmGKBiPA37962
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IP0D Eukaryota
ENOG4111TR7 LUCA
GeneTreeiENSGT00510000048608
HOVERGENiHBG006183
InParanoidiQ9NQ38
OMAiMHVNKCA
OrthoDBiEOG091G14HG
PhylomeDBiQ9NQ38
TreeFamiTF336724

Enzyme and pathway databases

ReactomeiR-HSA-6809371 Formation of the cornified envelope
SABIO-RKiQ9NQ38

Miscellaneous databases

ChiTaRSiSPINK5 human
EvolutionaryTraceiQ9NQ38
GeneWikiiLEKTI
GenomeRNAii11005
PMAP-CutDBiQ9NQ38
PROiPR:Q9NQ38
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000133710 Expressed in 130 organ(s), highest expression level in mouth mucosa
CleanExiHS_SPINK5
ExpressionAtlasiQ9NQ38 baseline and differential
GenevisibleiQ9NQ38 HS

Family and domain databases

InterProiView protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
PfamiView protein in Pfam
PF00050 Kazal_1, 11 hits
SMARTiView protein in SMART
SM00280 KAZAL, 14 hits
SUPFAMiSSF100895 SSF100895, 15 hits
PROSITEiView protein in PROSITE
PS00282 KAZAL_1, 2 hits
PS51465 KAZAL_2, 14 hits
ProtoNetiSearch...

Entry informationi

Entry nameiISK5_HUMAN
AccessioniPrimary (citable) accession number: Q9NQ38
Secondary accession number(s): A8MYE8
, B7WPB7, D6REN5, O75770, Q3LX95, Q3LX96, Q3LX97, Q96PP2, Q96PP3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 4, 2001
Last sequence update: November 4, 2008
Last modified: November 7, 2018
This is version 176 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again