Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (17 Jun 2020)
Sequence version 3 (12 Sep 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Signal peptide, CUB and EGF-like domain-containing protein 2

Gene

SCUBE2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Lipid-binding protein required for SHH long-range signaling by binding to the dually lipid-modified SHH (ShhNp) and by promoting ShhNp mobilization, solubilization and release from the cell membrane (PubMed:22902404, PubMed:22677548). Acts by enhancing the proteolytic processing (shedding) of the lipid-modified N- and C- terminal of ShhNp at the cell surface (PubMed:24522195). Synergizes with DISP1 to increase SHH secretion (PubMed:22902404). Probable cell surface coreceptor for VEGFR2 involved in VEGFR2-mediated angiogenesis (PubMed:27834687).1 Publication4 Publications

Caution

It is unclear how SCUBE2 binds the dilipidated SHH. According to a report, the SHH cholesterol-anchor, but not palmitate, seems to be both necessary and sufficient for SCUBE2-mediated SHH release from the cell membrane (PubMed:22902404). According to a second paper, palmitoylation accelerates the rate of SCUBE2-mediated release (PubMed:22677548). Cholesterol modification is sufficient for a heterologous protein to bind to SCUBE2 and to be secreted in a SCUBE2-dependent manner (PubMed:22902404).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
LigandCalcium, Lipid-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5362798 Release of Hh-Np from the secreting cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Signal peptide, CUB and EGF-like domain-containing protein 21 Publication
Alternative name(s):
Protein CEGP1By similarity
Scube/YouBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SCUBE2Imported
Synonyms:CEGP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000175356.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30425 SCUBE2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611747 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NQ36

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57758

Open Targets

More...
OpenTargetsi
ENSG00000175356

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134908812

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NQ36 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SCUBE2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033510

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 31Sequence analysisAdd BLAST31
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000025558032 – 999Signal peptide, CUB and EGF-like domain-containing protein 2Add BLAST968

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi49 ↔ 62By similarity
Disulfide bondi56 ↔ 71By similarity
Disulfide bondi73 ↔ 84By similarity
Disulfide bondi90 ↔ 102By similarity
Disulfide bondi98 ↔ 111By similarity
Disulfide bondi113 ↔ 126By similarity
Disulfide bondi368 ↔ 378By similarity
Disulfide bondi374 ↔ 387By similarity
Disulfide bondi389 ↔ 401By similarity
Disulfide bondi407 ↔ 418By similarity
Disulfide bondi414 ↔ 427By similarity
Disulfide bondi429 ↔ 442By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi659N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi809 ↔ 835By similarity
Disulfide bondi862 ↔ 883By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NQ36

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NQ36

PeptideAtlas

More...
PeptideAtlasi
Q9NQ36

PRoteomics IDEntifications database

More...
PRIDEi
Q9NQ36

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
82071 [Q9NQ36-1]
82072 [Q9NQ36-2]
82073 [Q9NQ36-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1745

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NQ36

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NQ36

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in a broad spectrum of adult tissues (PubMed:12270931).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000175356 Expressed in fundus of stomach and 166 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NQ36 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NQ36 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000175356 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SHH via the cholesterol anchor of the dually lipid-modified SHH (ShhNp) (PubMed:19480626, PubMed:22902404).

Interacts with PTCH1 (PubMed:19480626, PubMed:22902404). Forms homooligomers and heterooligomers with SCUBE1 and SCUBE3 (By similarity).

Interacts with VEGFR2 (PubMed:27834687).

By similarity3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121754, 1 interactor

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9NQ36 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NQ36

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 85EGF-like 1; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini86 – 127EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST42
Domaini128 – 168EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini177 – 213EGF-like 4PROSITE-ProRule annotationAdd BLAST37
Domaini217 – 252EGF-like 5PROSITE-ProRule annotationAdd BLAST36
Domaini286 – 321EGF-like 6PROSITE-ProRule annotationAdd BLAST36
Domaini323 – 363EGF-like 7; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini364 – 402EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd BLAST39
Domaini403 – 443EGF-like 9; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini809 – 921CUBPROSITE-ProRule annotationAdd BLAST113

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni847 – 856Interaction with the cholesterol-anchor of SHHBy similarity10

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The CUB domain is important for the interaction with the cholesterol-anchor of SHH. The CUB domain regulates protease recruitment and activation during SHH shedding.1 Publication

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153185

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_013079_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NQ36

Identification of Orthologs from Complete Genome Data

More...
OMAi
LFQDCET

Database of Orthologous Groups

More...
OrthoDBi
73164at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NQ36

TreeFam database of animal gene trees

More...
TreeFami
TF351672

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00041 CUB, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.290, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026823 cEGF
IPR000859 CUB_dom
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR024731 EGF_dom
IPR009030 Growth_fac_rcpt_cys_sf
IPR035914 Sperma_CUB_dom_sf
IPR011641 Tyr-kin_ephrin_A/B_rcpt-like

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12662 cEGF, 1 hit
PF00431 CUB, 1 hit
PF12947 EGF_3, 1 hit
PF07645 EGF_CA, 1 hit
PF07699 Ephrin_rec_like, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00042 CUB, 1 hit
SM00181 EGF, 10 hits
SM00179 EGF_CA, 8 hits
SM01411 Ephrin_rec_like, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49854 SSF49854, 1 hit
SSF57184 SSF57184, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 6 hits
PS01180 CUB, 1 hit
PS01186 EGF_2, 8 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NQ36-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGVAGRNRPG AAWAVLLLLL LLPPLLLLAG AVPPGRGRAA GPQEDVDECA
60 70 80 90 100
QGLDDCHADA LCQNTPTSYK CSCKPGYQGE GRQCEDIDEC GNELNGGCVH
110 120 130 140 150
DCLNIPGNYR CTCFDGFMLA HDGHNCLDVD ECLENNGGCQ HTCVNVMGSY
160 170 180 190 200
ECCCKEGFFL SDNQHTCIHR SEEGLSCMNK DHGCSHICKE APRGSVACEC
210 220 230 240 250
RPGFELAKNQ RDCILTCNHG NGGCQHSCDD TADGPECSCH PQYKMHTDGR
260 270 280 290 300
SCLEREDTVL EVTESNTTSV VDGDKRVKRR LLMETCAVNN GGCDRTCKDT
310 320 330 340 350
STGVHCSCPV GFTLQLDGKT CKDIDECQTR NGGCDHFCKN IVGSFDCGCK
360 370 380 390 400
KGFKLLTDEK SCQDVDECSL DRTCDHSCIN HPGTFACACN RGYTLYGFTH
410 420 430 440 450
CGDTNECSIN NGGCQQVCVN TVGSYECQCH PGYKLHWNKK DCVEVKGLLP
460 470 480 490 500
TSVSPRVSLH CGKSGGGDGC FLRCHSGIHL SSDVTTIRTS VTFKLNEGKC
510 520 530 540 550
SLKNAELFPE GLRPALPEKH SSVKESFRYV NLTCSSGKQV PGAPGRPSTP
560 570 580 590 600
KEMFITVEFE LETNQKEVTA SCDLSCIVKR TEKRLRKAIR TLRKAVHREQ
610 620 630 640 650
FHLQLSGMNL DVAKKPPRTS ERQAESCGVG QGHAENQCVS CRAGTYYDGA
660 670 680 690 700
RERCILCPNG TFQNEEGQMT CEPCPRPGNS GALKTPEAWN MSECGGLCQP
710 720 730 740 750
GEYSADGFAP CQLCALGTFQ PEAGRTSCFP CGGGLATKHQ GATSFQDCET
760 770 780 790 800
RVQCSPGHFY NTTTHRCIRC PVGTYQPEFG KNNCVSCPGN TTTDFDGSTN
810 820 830 840 850
ITQCKNRRCG GELGDFTGYI ESPNYPGNYP ANTECTWTIN PPPKRRILIV
860 870 880 890 900
VPEIFLPIED DCGDYLVMRK TSSSNSVTTY ETCQTYERPI AFTSRSKKLW
910 920 930 940 950
IQFKSNEGNS ARGFQVPYVT YDEDYQELIE DIVRDGRLYA SENHQEILKD
960 970 980 990
KKLIKALFDV LAHPQNYFKY TAQESREMFP RSFIRLLRSK VSRFLRPYK
Length:999
Mass (Da):109,957
Last modified:September 12, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i61334844A0053095
GO
Isoform 2 (identifier: Q9NQ36-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     482-482: S → SGLQGAYSVTCGSSSPLRNKQQKSNDSAFG
     639-695: Missing.

Show »
Length:971
Mass (Da):106,757
Checksum:iA0B038D8DFA83DF6
GO
Isoform 3 (identifier: Q9NQ36-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     444-569: Missing.
     806-872: NRRCGGELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDCGDYLVMRKTS → T

Show »
Length:807
Mass (Da):88,870
Checksum:iC7238579322EFE62
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B3ISZ7A0A3B3ISZ7_HUMAN
Signal peptide, CUB and EGF-like do...
SCUBE2
1,028Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YEB3H0YEB3_HUMAN
Signal peptide, CUB and EGF-like do...
SCUBE2
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDN3H0YDN3_HUMAN
Signal peptide, CUB and EGF-like do...
SCUBE2
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YEI5H0YEI5_HUMAN
Signal peptide, CUB and EGF-like do...
SCUBE2
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YD28H0YD28_HUMAN
Signal peptide, CUB and EGF-like do...
SCUBE2
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti916V → G in BAC85521 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_028870591T → M1 PublicationCorresponds to variant dbSNP:rs3751055Ensembl.1
Natural variantiVAR_028871712Q → H. Corresponds to variant dbSNP:rs7395988Ensembl.1
Natural variantiVAR_028872752V → G. Corresponds to variant dbSNP:rs12419343Ensembl.1
Natural variantiVAR_028873791T → S. Corresponds to variant dbSNP:rs3751057Ensembl.1
Natural variantiVAR_028874843P → R. Corresponds to variant dbSNP:rs3751059Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_021293444 – 569Missing in isoform 3. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_021294482S → SGLQGAYSVTCGSSSPLRNK QQKSNDSAFG in isoform 2. 1 Publication1
Alternative sequenceiVSP_039955639 – 695Missing in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_021295806 – 872NRRCG…MRKTS → T in isoform 3. 1 PublicationAdd BLAST67

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ400877 Genomic DNA Translation: CAB92285.1
AK123039 mRNA Translation: BAC85521.1
AC079296 Genomic DNA No translation available.
BC111690 mRNA Translation: AAI11691.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53599.1 [Q9NQ36-3]
CCDS7797.2 [Q9NQ36-2]
CCDS81553.1 [Q9NQ36-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001164161.1, NM_001170690.1 [Q9NQ36-3]
NP_001317128.1, NM_001330199.1 [Q9NQ36-1]
NP_066025.2, NM_020974.2 [Q9NQ36-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000309263; ENSP00000310658; ENSG00000175356 [Q9NQ36-1]
ENST00000450649; ENSP00000415187; ENSG00000175356 [Q9NQ36-3]
ENST00000520467; ENSP00000429969; ENSG00000175356 [Q9NQ36-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57758

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57758

UCSC genome browser

More...
UCSCi
uc001mhj.3 human [Q9NQ36-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ400877 Genomic DNA Translation: CAB92285.1
AK123039 mRNA Translation: BAC85521.1
AC079296 Genomic DNA No translation available.
BC111690 mRNA Translation: AAI11691.1
CCDSiCCDS53599.1 [Q9NQ36-3]
CCDS7797.2 [Q9NQ36-2]
CCDS81553.1 [Q9NQ36-1]
RefSeqiNP_001164161.1, NM_001170690.1 [Q9NQ36-3]
NP_001317128.1, NM_001330199.1 [Q9NQ36-1]
NP_066025.2, NM_020974.2 [Q9NQ36-2]

3D structure databases

SMRiQ9NQ36
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi121754, 1 interactor

PTM databases

GlyConnecti1745
iPTMnetiQ9NQ36
PhosphoSitePlusiQ9NQ36

Polymorphism and mutation databases

BioMutaiSCUBE2
DMDMi311033510

Proteomic databases

jPOSTiQ9NQ36
MassIVEiQ9NQ36
PeptideAtlasiQ9NQ36
PRIDEiQ9NQ36
ProteomicsDBi82071 [Q9NQ36-1]
82072 [Q9NQ36-2]
82073 [Q9NQ36-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1601 171 antibodies

The DNASU plasmid repository

More...
DNASUi
57758

Genome annotation databases

EnsembliENST00000309263; ENSP00000310658; ENSG00000175356 [Q9NQ36-1]
ENST00000450649; ENSP00000415187; ENSG00000175356 [Q9NQ36-3]
ENST00000520467; ENSP00000429969; ENSG00000175356 [Q9NQ36-2]
GeneIDi57758
KEGGihsa:57758
UCSCiuc001mhj.3 human [Q9NQ36-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57758
DisGeNETi57758
EuPathDBiHostDB:ENSG00000175356.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SCUBE2
HGNCiHGNC:30425 SCUBE2
HPAiENSG00000175356 Low tissue specificity
MIMi611747 gene
neXtProtiNX_Q9NQ36
OpenTargetsiENSG00000175356
PharmGKBiPA134908812

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000153185
HOGENOMiCLU_013079_0_0_1
InParanoidiQ9NQ36
OMAiLFQDCET
OrthoDBi73164at2759
PhylomeDBiQ9NQ36
TreeFamiTF351672

Enzyme and pathway databases

ReactomeiR-HSA-5362798 Release of Hh-Np from the secreting cell

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
57758 1 hit in 787 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SCUBE2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57758
PharosiQ9NQ36 Tbio

Protein Ontology

More...
PROi
PR:Q9NQ36
RNActiQ9NQ36 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000175356 Expressed in fundus of stomach and 166 other tissues
ExpressionAtlasiQ9NQ36 baseline and differential
GenevisibleiQ9NQ36 HS

Family and domain databases

CDDicd00041 CUB, 1 hit
Gene3Di2.60.120.290, 1 hit
InterProiView protein in InterPro
IPR026823 cEGF
IPR000859 CUB_dom
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR024731 EGF_dom
IPR009030 Growth_fac_rcpt_cys_sf
IPR035914 Sperma_CUB_dom_sf
IPR011641 Tyr-kin_ephrin_A/B_rcpt-like
PfamiView protein in Pfam
PF12662 cEGF, 1 hit
PF00431 CUB, 1 hit
PF12947 EGF_3, 1 hit
PF07645 EGF_CA, 1 hit
PF07699 Ephrin_rec_like, 3 hits
SMARTiView protein in SMART
SM00042 CUB, 1 hit
SM00181 EGF, 10 hits
SM00179 EGF_CA, 8 hits
SM01411 Ephrin_rec_like, 3 hits
SUPFAMiSSF49854 SSF49854, 1 hit
SSF57184 SSF57184, 4 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 6 hits
PS01180 CUB, 1 hit
PS01186 EGF_2, 8 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSCUB2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQ36
Secondary accession number(s): Q2NKQ8, Q6ZWI1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: September 12, 2018
Last modified: June 17, 2020
This is version 150 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again