Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 111 (31 Jul 2019)
Sequence version 3 (05 Oct 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Uncharacterized protein C11orf16

Gene

C11orf16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein C11orf16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1169 C11orf16

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NQ32

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000176029

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C11orf16

Domain mapping of disease mutations (DMDM)

More...
DMDMi
308153616

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000898321 – 467Uncharacterized protein C11orf16Add BLAST467

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NQ32

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NQ32

PeptideAtlas

More...
PeptideAtlasi
Q9NQ32

PRoteomics IDEntifications database

More...
PRIDEi
Q9NQ32

ProteomicsDB human proteome resource

More...
ProteomicsDBi
82066 [Q9NQ32-1]
82067 [Q9NQ32-2]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NQ32

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000176029 Expressed in 153 organ(s), highest expression level in epithelium of bronchus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NQ32 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NQ32 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121181, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NQ32, 2 interactors

Molecular INTeraction database

More...
MINTi
Q9NQ32

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000318999

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NQ32

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKHI Eukaryota
ENOG410YKXR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012348

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111719

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NQ32

Identification of Orthologs from Complete Genome Data

More...
OMAi
LLWAPCC

Database of Orthologous Groups

More...
OrthoDBi
1189809at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NQ32

TreeFam database of animal gene trees

More...
TreeFami
TF336135

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032770 DUF4537

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15057 DUF4537, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NQ32-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESSTGPRMP LLKYCSVATS LKAPGWDGAA PPWDLSFTYP FALQAPWLTG
60 70 80 90 100
HKPLARHASS CPCLHVADPA WQGPGWLGRA GDAANTWVLA RREADGFYYR
110 120 130 140 150
AQIKATPELE RQGVLLVEFE APLVAGPKLP AQQQRVVLEE DVIPLSPSVG
160 170 180 190 200
YSLRPGDKVL ALWEPGQQQY GPGTVLLGLE MRDPQRASKE KEITVHFWNG
210 220 230 240 250
KAAKVPLGGV QSVSLTIWKK AVERLHKSFT REHPRPLHWA PCCSLLGPIT
260 270 280 290 300
GRITNELPPD APFLCPLCHH HACCQLLCQG CLCGCPPCGT TWWPLTRTSE
310 320 330 340 350
VMARELPELE PTAQLLPLEG PKEEKVAMHA PLAVSSSSSS SCEQDGVEND
360 370 380 390 400
LEMGPPQRLM VNSAVNTDPI FLEMPLRQSG LCQPEWRYWK RNGPEPCLGK
410 420 430 440 450
PGTRYSNICK EEKDHKQQRA QTAVVGTTKE LVSKATHMKP PRTPPGEAEH
460
RKRSQSLAIC QWNKNSR
Length:467
Mass (Da):51,609
Last modified:October 5, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i10FB8E35E60D2298
GO
Isoform 2 (identifier: Q9NQ32-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     403-467: TRYSNICKEEKDHKQQRAQTAVVGTTKELVSKATHMKPPRTPPGEAEHRKRSQSLAICQWNKNSR → KE

Show »
Length:404
Mass (Da):44,412
Checksum:iB7AA221DC6D6CEFF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PNY9E9PNY9_HUMAN
Uncharacterized protein C11orf16
C11orf16
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti169Q → R in BAD97097 (Ref. 2) Curated1
Sequence conflicti311P → A in BAD97097 (Ref. 2) Curated1
Sequence conflicti311P → A in AAH27865 (PubMed:15489334).Curated1
Sequence conflicti398L → P in CAB92289 (PubMed:11528127).Curated1
Sequence conflicti398L → P in BAD97097 (Ref. 2) Curated1
Sequence conflicti398L → P in AAH27865 (PubMed:15489334).Curated1
Sequence conflicti423A → V in CAB92289 (PubMed:11528127).Curated1
Sequence conflicti423A → V in BAD97097 (Ref. 2) Curated1
Sequence conflicti442R → Q in CAB92289 (PubMed:11528127).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_056827144P → L. Corresponds to variant dbSNP:rs2568076Ensembl.1
Natural variantiVAR_056828210V → L1 PublicationCorresponds to variant dbSNP:rs11042127Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039850403 – 467TRYSN…NKNSR → KE in isoform 2. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ400877 Genomic DNA Translation: CAB92289.1
AK223377 mRNA Translation: BAD97097.1
AC026894 Genomic DNA No translation available.
BC027865 mRNA Translation: AAH27865.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7794.1 [Q9NQ32-1]

NCBI Reference Sequences

More...
RefSeqi
NP_065694.2, NM_020643.2 [Q9NQ32-1]
XP_016873502.1, XM_017018013.1 [Q9NQ32-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000326053; ENSP00000318999; ENSG00000176029 [Q9NQ32-1]
ENST00000525780; ENSP00000436818; ENSG00000176029 [Q9NQ32-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56673

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56673

UCSC genome browser

More...
UCSCi
uc001mhb.5 human [Q9NQ32-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ400877 Genomic DNA Translation: CAB92289.1
AK223377 mRNA Translation: BAD97097.1
AC026894 Genomic DNA No translation available.
BC027865 mRNA Translation: AAH27865.1
CCDSiCCDS7794.1 [Q9NQ32-1]
RefSeqiNP_065694.2, NM_020643.2 [Q9NQ32-1]
XP_016873502.1, XM_017018013.1 [Q9NQ32-1]

3D structure databases

SMRiQ9NQ32
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121181, 3 interactors
IntActiQ9NQ32, 2 interactors
MINTiQ9NQ32
STRINGi9606.ENSP00000318999

PTM databases

PhosphoSitePlusiQ9NQ32

Polymorphism and mutation databases

BioMutaiC11orf16
DMDMi308153616

Proteomic databases

jPOSTiQ9NQ32
PaxDbiQ9NQ32
PeptideAtlasiQ9NQ32
PRIDEiQ9NQ32
ProteomicsDBi82066 [Q9NQ32-1]
82067 [Q9NQ32-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326053; ENSP00000318999; ENSG00000176029 [Q9NQ32-1]
ENST00000525780; ENSP00000436818; ENSG00000176029 [Q9NQ32-2]
GeneIDi56673
KEGGihsa:56673
UCSCiuc001mhb.5 human [Q9NQ32-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56673

GeneCards: human genes, protein and diseases

More...
GeneCardsi
C11orf16
HGNCiHGNC:1169 C11orf16
neXtProtiNX_Q9NQ32
OpenTargetsiENSG00000176029

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IKHI Eukaryota
ENOG410YKXR LUCA
GeneTreeiENSGT00390000012348
HOGENOMiHOG000111719
InParanoidiQ9NQ32
OMAiLLWAPCC
OrthoDBi1189809at2759
PhylomeDBiQ9NQ32
TreeFamiTF336135

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
C11orf16

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56673

Protein Ontology

More...
PROi
PR:Q9NQ32

Gene expression databases

BgeeiENSG00000176029 Expressed in 153 organ(s), highest expression level in epithelium of bronchus
ExpressionAtlasiQ9NQ32 baseline and differential
GenevisibleiQ9NQ32 HS

Family and domain databases

InterProiView protein in InterPro
IPR032770 DUF4537
PfamiView protein in Pfam
PF15057 DUF4537, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCK016_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NQ32
Secondary accession number(s): Q53FB2, Q8N6Y9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: October 5, 2010
Last modified: July 31, 2019
This is version 111 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again