Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (16 Oct 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NTF2-related export protein 2

Gene

NXT2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processmRNA transport, Protein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NTF2-related export protein 2
Alternative name(s):
Protein p15-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NXT2
ORF Names:BM-025, DC9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18151 NXT2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300320 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NPJ8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000101888

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134928861

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9NPJ8

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NXT2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001947951 – 142NTF2-related export protein 2Add BLAST142

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NPJ8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NPJ8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NPJ8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NPJ8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NPJ8

PeptideAtlas

More...
PeptideAtlasi
Q9NPJ8

PRoteomics IDEntifications database

More...
PRIDEi
Q9NPJ8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
82029 [Q9NPJ8-1]
82030 [Q9NPJ8-2]
82031 [Q9NPJ8-3]
82032 [Q9NPJ8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NPJ8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NPJ8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101888 Expressed in 214 organ(s), highest expression level in female gonad

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NPJ8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA024199
HPA072010

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Associates with NXF1, NXF2, NXF3 and NXF5.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120999, 24 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NPJ8, 28 interactors

Molecular INTeraction database

More...
MINTi
Q9NPJ8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000218004

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NPJ8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini17 – 136NTF2PROSITE-ProRule annotationAdd BLAST120

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4353 Eukaryota
ENOG4111TWR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156381

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NPJ8

KEGG Orthology (KO)

More...
KOi
K14285

Identification of Orthologs from Complete Genome Data

More...
OMAi
MGDKWKI

Database of Orthologous Groups

More...
OrthoDBi
1450028at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NPJ8

TreeFam database of animal gene trees

More...
TreeFami
TF318944

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00780 NTF2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002075 NTF2
IPR032710 NTF2-like_dom_sf
IPR018222 Nuclear_transport_factor_2_euk

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02136 NTF2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54427 SSF54427, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50177 NTF2_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NPJ8-1) [UniParc]FASTAAdd to basket
Also known as: A, p15-2a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATSLDFKTY VDQACRAAEE FVNIYYETMD KRRRALTRLY LDKATLIWNG
60 70 80 90 100
NAVSGLDALN NFFDTLPSSE FQVNMLDCQP VHEQATQSQT TVLVVTSGTV
110 120 130 140
KFDGNKQHFF NQNFLLTAQS TPNNTVWKIA SDCFRFQDWS SS
Length:142
Mass (Da):16,228
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i009B4E8929A6BA6C
GO
Isoform 2 (identifier: Q9NPJ8-2) [UniParc]FASTAAdd to basket
Also known as: B, p15-2b

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MATSL → VTNHVPALCTAGRGPRFAARPAGPTPSLVSSRFLIPERTLSWEIARGGDVG

Note: Incomplete sequence.
Show »
Length:188
Mass (Da):21,050
Checksum:i571C1FF74EE21CB1
GO
Isoform 3 (identifier: Q9NPJ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRKYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQM

Show »
Length:197
Mass (Da):22,728
Checksum:i47BD5E5D4A8C18F9
GO
Isoform 4 (identifier: Q9NPJ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: Missing.

Show »
Length:114
Mass (Da):12,967
Checksum:i4794D8D4893867F4
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB14511 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0375391 – 28Missing in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0036041 – 5MATSL → VTNHVPALCTAGRGPRFAAR PAGPTPSLVSSRFLIPERTL SWEIARGGDVG in isoform 2. 1 Publication5
Alternative sequenceiVSP_0375401M → MRKYRSHWSQGDREGYQRRS NYYEGPHTSHSSPADRTREE VVTPTLPEHTATRSQM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ277591 mRNA Translation: CAB96371.1
AJ278323 mRNA Translation: CAC01129.1
AF246127 mRNA Translation: AAF78034.1
AF201942 mRNA Translation: AAF86878.1
AF212223 mRNA Translation: AAF87325.1
AK023289 mRNA Translation: BAB14511.1 Different initiation.
AL031387 Genomic DNA No translation available.
CH471120 Genomic DNA Translation: EAX02677.1
CH471120 Genomic DNA Translation: EAX02678.1
BC014888 mRNA No translation available.
CH471120 Genomic DNA Translation: EAX02680.1
BC120984 mRNA Translation: AAI20985.1
BC120985 mRNA Translation: AAI20986.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14546.1 [Q9NPJ8-3]
CCDS56605.1 [Q9NPJ8-1]
CCDS56606.1 [Q9NPJ8-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001229546.1, NM_001242617.1 [Q9NPJ8-1]
NP_001229547.1, NM_001242618.1 [Q9NPJ8-4]
NP_061168.2, NM_018698.4 [Q9NPJ8-3]
XP_016885137.1, XM_017029648.1 [Q9NPJ8-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000218004; ENSP00000218004; ENSG00000101888 [Q9NPJ8-3]
ENST00000372103; ENSP00000361175; ENSG00000101888 [Q9NPJ8-4]
ENST00000372106; ENSP00000361178; ENSG00000101888 [Q9NPJ8-1]
ENST00000372107; ENSP00000361179; ENSG00000101888 [Q9NPJ8-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55916

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55916

UCSC genome browser

More...
UCSCi
uc004eoe.3 human [Q9NPJ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277591 mRNA Translation: CAB96371.1
AJ278323 mRNA Translation: CAC01129.1
AF246127 mRNA Translation: AAF78034.1
AF201942 mRNA Translation: AAF86878.1
AF212223 mRNA Translation: AAF87325.1
AK023289 mRNA Translation: BAB14511.1 Different initiation.
AL031387 Genomic DNA No translation available.
CH471120 Genomic DNA Translation: EAX02677.1
CH471120 Genomic DNA Translation: EAX02678.1
BC014888 mRNA No translation available.
CH471120 Genomic DNA Translation: EAX02680.1
BC120984 mRNA Translation: AAI20985.1
BC120985 mRNA Translation: AAI20986.1
CCDSiCCDS14546.1 [Q9NPJ8-3]
CCDS56605.1 [Q9NPJ8-1]
CCDS56606.1 [Q9NPJ8-4]
RefSeqiNP_001229546.1, NM_001242617.1 [Q9NPJ8-1]
NP_001229547.1, NM_001242618.1 [Q9NPJ8-4]
NP_061168.2, NM_018698.4 [Q9NPJ8-3]
XP_016885137.1, XM_017029648.1 [Q9NPJ8-4]

3D structure databases

SMRiQ9NPJ8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120999, 24 interactors
IntActiQ9NPJ8, 28 interactors
MINTiQ9NPJ8
STRINGi9606.ENSP00000218004

PTM databases

iPTMnetiQ9NPJ8
PhosphoSitePlusiQ9NPJ8

Polymorphism and mutation databases

BioMutaiNXT2

Proteomic databases

EPDiQ9NPJ8
jPOSTiQ9NPJ8
MassIVEiQ9NPJ8
MaxQBiQ9NPJ8
PaxDbiQ9NPJ8
PeptideAtlasiQ9NPJ8
PRIDEiQ9NPJ8
ProteomicsDBi82029 [Q9NPJ8-1]
82030 [Q9NPJ8-2]
82031 [Q9NPJ8-3]
82032 [Q9NPJ8-4]

Genome annotation databases

EnsembliENST00000218004; ENSP00000218004; ENSG00000101888 [Q9NPJ8-3]
ENST00000372103; ENSP00000361175; ENSG00000101888 [Q9NPJ8-4]
ENST00000372106; ENSP00000361178; ENSG00000101888 [Q9NPJ8-1]
ENST00000372107; ENSP00000361179; ENSG00000101888 [Q9NPJ8-4]
GeneIDi55916
KEGGihsa:55916
UCSCiuc004eoe.3 human [Q9NPJ8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55916

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NXT2
HGNCiHGNC:18151 NXT2
HPAiHPA024199
HPA072010
MIMi300320 gene
neXtProtiNX_Q9NPJ8
OpenTargetsiENSG00000101888
PharmGKBiPA134928861

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4353 Eukaryota
ENOG4111TWR LUCA
GeneTreeiENSGT00940000156381
InParanoidiQ9NPJ8
KOiK14285
OMAiMGDKWKI
OrthoDBi1450028at2759
PhylomeDBiQ9NPJ8
TreeFamiTF318944

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NXT2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55916
PharosiQ9NPJ8

Protein Ontology

More...
PROi
PR:Q9NPJ8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101888 Expressed in 214 organ(s), highest expression level in female gonad
GenevisibleiQ9NPJ8 HS

Family and domain databases

CDDicd00780 NTF2, 1 hit
InterProiView protein in InterPro
IPR002075 NTF2
IPR032710 NTF2-like_dom_sf
IPR018222 Nuclear_transport_factor_2_euk
PfamiView protein in Pfam
PF02136 NTF2, 1 hit
SUPFAMiSSF54427 SSF54427, 1 hit
PROSITEiView protein in PROSITE
PS50177 NTF2_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNXT2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NPJ8
Secondary accession number(s): D3DUY1
, Q0VAN8, Q5JYV5, Q5JYV6, Q5JYV7, Q9H8U0, Q9NQ64, Q9NRL7, Q9Y3M4, Q9Y3M5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2001
Last sequence update: October 1, 2000
Last modified: October 16, 2019
This is version 162 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again