Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proline-rich nuclear receptor coactivator 2

Gene

PNRC2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery (PubMed:19150429). May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs (PubMed:19150429). Required for UPF1/RENT1 localization to the P-body (PubMed:19150429). Plays a role in glucocorticoid receptor-mediated mRNA degradation by interacting with the glucocorticoid receptor NR3C1 in a ligand-dependent manner when it is bound to the 5' UTR of target mRNAs and recruiting the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay (PubMed:25775514). Also acts as a nuclear receptor coactivator (PubMed:11574675). May play a role in controlling the energy balance between energy storage and energy expenditure (By similarity).By similarity3 Publications

GO - Biological processi

  • deadenylation-independent decapping of nuclear-transcribed mRNA Source: UniProtKB
  • nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Source: UniProtKB

Keywordsi

Molecular functionActivator
Biological processNonsense-mediated mRNA decay, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-975957 Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Names & Taxonomyi

Protein namesi
Recommended name:
Proline-rich nuclear receptor coactivator 2
Gene namesi
Name:PNRC2
ORF Names:HSPC208
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000189266.11
HGNCiHGNC:23158 PNRC2
MIMi611882 gene
neXtProtiNX_Q9NPJ4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi101P → A: Abolishes the interaction with the nuclear receptors but not decapping enzyme; when associated with A-104. 2 Publications1
Mutagenesisi104P → A: Abolishes the interaction with the nuclear receptors but not decapping enzyme; when associated with A-101. 2 Publications1
Mutagenesisi108P → A: Abolishes the interaction with DCP1A. 1 Publication1
Mutagenesisi114W → A: Abolishes the interaction with DCP1A. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000189266
PharmGKBiPA134931421

Polymorphism and mutation databases

BioMutaiPNRC2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000584851 – 139Proline-rich nuclear receptor coactivator 2Add BLAST139

Proteomic databases

EPDiQ9NPJ4
MaxQBiQ9NPJ4
PaxDbiQ9NPJ4
PeptideAtlasiQ9NPJ4
PRIDEiQ9NPJ4
ProteomicsDBi82026
82027 [Q9NPJ4-2]

PTM databases

iPTMnetiQ9NPJ4
PhosphoSitePlusiQ9NPJ4

Expressioni

Tissue specificityi

Expressed in heart, lung, muscle and brain.1 Publication

Gene expression databases

BgeeiENSG00000189266 Expressed in 237 organ(s), highest expression level in germinal epithelium of ovary
CleanExiHS_PNRC2
ExpressionAtlasiQ9NPJ4 baseline and differential
GenevisibleiQ9NPJ4 HS

Organism-specific databases

HPAiHPA027820
HPA045837

Interactioni

Subunit structurei

Interacts with UPF1/RENT1; preferentially interacts with hyperphosphorylated form (PubMed:19150429, PubMed:25775514). Interacts with DCP1A (PubMed:19150429, PubMed:25775514). Interacts with many nuclear receptors including ESR1, ESRRA, ESRRG, NR3C1/GR, NR5A1, PGR, TR, RAR and RXR (PubMed:11574675, PubMed:14651967, PubMed:25775514).4 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi120768, 15 interactors
DIPiDIP-41328N
IntActiQ9NPJ4, 15 interactors
MINTiQ9NPJ4
STRINGi9606.ENSP00000383587

Structurei

Secondary structure

1139
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9NPJ4
SMRiQ9NPJ4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi99 – 105SH3-binding7

Domaini

The interaction between PNRC2 and nuclear receptors is dependent on the SH3 binding motif.1 Publication

Sequence similaritiesi

Belongs to the PNRC family. PNRC2 subfamily.Curated

Phylogenomic databases

eggNOGiENOG410IY3T Eukaryota
ENOG4112BTC LUCA
GeneTreeiENSGT00530000063881
HOGENOMiHOG000115593
HOVERGENiHBG053627
InParanoidiQ9NPJ4
KOiK18751
OMAiERGHTYN
OrthoDBiEOG091G0SY3
PhylomeDBiQ9NPJ4
TreeFamiTF333211

Family and domain databases

InterProiView protein in InterPro
IPR026780 PNRC1/2
IPR026781 PNRC2
PANTHERiPTHR15405 PTHR15405, 1 hit
PTHR15405:SF6 PTHR15405:SF6, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NPJ4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGGERYNIP APQSRNVSKN QQQLNRQKTK EQNSQMKIVH KKKERGHGYN
60 70 80 90 100
SSAAAWQAMQ NGGKNKNFPN NQSWNSSLSG PRLLFKSQAN QNYAGAKFSE
110 120 130
PPSPSVLPKP PSHWVPVSFN PSDKEIMTFQ LKTLLKVQV
Length:139
Mass (Da):15,591
Last modified:October 1, 2000 - v1
Checksum:i072039CB52551F90
GO
Isoform 2 (identifier: Q9NPJ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MGGGERYNIP...RGHGYNSSAA → MLASAPRLNSADRPMKTSVLRQRKGSVRKQHLLSW

Note: No experimental confirmation available.
Show »
Length:120
Mass (Da):13,471
Checksum:i185AC9A23E50218B
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KS97J3KS97_HUMAN
Proline-rich nuclear receptor coact...
PNRC2
56Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0374631 – 54MGGGE…NSSAA → MLASAPRLNSADRPMKTSVL RQRKGSVRKQHLLSW in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF374386 mRNA Translation: AAK54613.1
AF151042 mRNA Translation: AAF36128.1
AK000319 mRNA Translation: BAA91082.1
AK300522 mRNA Translation: BAG62234.1
AL590609 Genomic DNA No translation available.
BC001959 mRNA Translation: AAH01959.1
BC078177 mRNA Translation: AAH78177.1
BC085018 mRNA Translation: AAH85018.1
CCDSiCCDS246.1 [Q9NPJ4-1]
RefSeqiNP_060231.1, NM_017761.3 [Q9NPJ4-1]
XP_016857180.1, XM_017001691.1 [Q9NPJ4-1]
UniGeneiHs.512636
Hs.644217
Hs.716935
Hs.7862

Genome annotation databases

EnsembliENST00000334351; ENSP00000334840; ENSG00000189266 [Q9NPJ4-1]
ENST00000374468; ENSP00000363592; ENSG00000189266 [Q9NPJ4-1]
GeneIDi55629
KEGGihsa:55629
UCSCiuc001big.4 human [Q9NPJ4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF374386 mRNA Translation: AAK54613.1
AF151042 mRNA Translation: AAF36128.1
AK000319 mRNA Translation: BAA91082.1
AK300522 mRNA Translation: BAG62234.1
AL590609 Genomic DNA No translation available.
BC001959 mRNA Translation: AAH01959.1
BC078177 mRNA Translation: AAH78177.1
BC085018 mRNA Translation: AAH85018.1
CCDSiCCDS246.1 [Q9NPJ4-1]
RefSeqiNP_060231.1, NM_017761.3 [Q9NPJ4-1]
XP_016857180.1, XM_017001691.1 [Q9NPJ4-1]
UniGeneiHs.512636
Hs.644217
Hs.716935
Hs.7862

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4B6HX-ray2.60C/D1-121[»]
5KQ1X-ray3.00C/F91-121[»]
5KQ4X-ray2.56C/F91-121[»]
ProteinModelPortaliQ9NPJ4
SMRiQ9NPJ4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120768, 15 interactors
DIPiDIP-41328N
IntActiQ9NPJ4, 15 interactors
MINTiQ9NPJ4
STRINGi9606.ENSP00000383587

PTM databases

iPTMnetiQ9NPJ4
PhosphoSitePlusiQ9NPJ4

Polymorphism and mutation databases

BioMutaiPNRC2

Proteomic databases

EPDiQ9NPJ4
MaxQBiQ9NPJ4
PaxDbiQ9NPJ4
PeptideAtlasiQ9NPJ4
PRIDEiQ9NPJ4
ProteomicsDBi82026
82027 [Q9NPJ4-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334351; ENSP00000334840; ENSG00000189266 [Q9NPJ4-1]
ENST00000374468; ENSP00000363592; ENSG00000189266 [Q9NPJ4-1]
GeneIDi55629
KEGGihsa:55629
UCSCiuc001big.4 human [Q9NPJ4-1]

Organism-specific databases

CTDi55629
EuPathDBiHostDB:ENSG00000189266.11
GeneCardsiPNRC2
H-InvDBiHIX0028821
HGNCiHGNC:23158 PNRC2
HPAiHPA027820
HPA045837
MIMi611882 gene
neXtProtiNX_Q9NPJ4
OpenTargetsiENSG00000189266
PharmGKBiPA134931421
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IY3T Eukaryota
ENOG4112BTC LUCA
GeneTreeiENSGT00530000063881
HOGENOMiHOG000115593
HOVERGENiHBG053627
InParanoidiQ9NPJ4
KOiK18751
OMAiERGHTYN
OrthoDBiEOG091G0SY3
PhylomeDBiQ9NPJ4
TreeFamiTF333211

Enzyme and pathway databases

ReactomeiR-HSA-975957 Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Miscellaneous databases

ChiTaRSiPNRC2 human
GeneWikiiPNRC2
GenomeRNAii55629
PROiPR:Q9NPJ4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000189266 Expressed in 237 organ(s), highest expression level in germinal epithelium of ovary
CleanExiHS_PNRC2
ExpressionAtlasiQ9NPJ4 baseline and differential
GenevisibleiQ9NPJ4 HS

Family and domain databases

InterProiView protein in InterPro
IPR026780 PNRC1/2
IPR026781 PNRC2
PANTHERiPTHR15405 PTHR15405, 1 hit
PTHR15405:SF6 PTHR15405:SF6, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPNRC2_HUMAN
AccessioniPrimary (citable) accession number: Q9NPJ4
Secondary accession number(s): B4DU72
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: October 1, 2000
Last modified: November 7, 2018
This is version 144 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again