Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 193 (18 Sep 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ras-related protein Rab-18

Gene

RAB18

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi15 – 23GTP9
Nucleotide bindingi63 – 67GTP5
Nucleotide bindingi122 – 125GTP4
Nucleotide bindingi151 – 153GTP3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processProtein transport, Transport
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6798695 Neutrophil degranulation
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-HSA-8873719 RAB geranylgeranylation
R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras-related protein Rab-18
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RAB18
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14244 RAB18

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602207 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9NP72

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Warburg micro syndrome 3 (WARBM3)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare syndrome characterized by microcephaly, microphthalmia, microcornia, congenital cataracts, optic atrophy, cortical dysplasia, in particular corpus callosum hypoplasia, severe mental retardation, spastic diplegia, and hypogonadism.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06649524L → Q in WARBM3. 1 PublicationCorresponds to variant dbSNP:rs387906832EnsemblClinVar.1
Natural variantiVAR_06649693Missing in WARBM3. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
22931

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
RAB18

MalaCards human disease database

More...
MalaCardsi
RAB18
MIMi614222 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000099246

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2510 Micro syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34106

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RAB18

Domain mapping of disease mutations (DMDM)

More...
DMDMi
12230528

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001211931 – 203Ras-related protein Rab-18Add BLAST203
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000370761204 – 206Removed in mature formSequence analysis3

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1
Modified residuei144PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi199S-palmitoyl cysteineSequence analysis1
Modified residuei203Cysteine methyl esterSequence analysis1
Lipidationi203S-geranylgeranyl cysteineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Palmitate, Phosphoprotein, Prenylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9NP72

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9NP72

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9NP72

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9NP72

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NP72

PeptideAtlas

More...
PeptideAtlasi
Q9NP72

PRoteomics IDEntifications database

More...
PRIDEi
Q9NP72

ProteomicsDB human proteome resource

More...
ProteomicsDBi
6488
81906 [Q9NP72-1]
81907 [Q9NP72-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NP72

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9NP72

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9NP72

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000099246 Expressed in 202 organ(s), highest expression level in metanephros

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NP72 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NP72 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA025928

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116591, 39 interactors

Database of interacting proteins

More...
DIPi
DIP-60514N

Protein interaction database and analysis system

More...
IntActi
Q9NP72, 37 interactors

Molecular INTeraction database

More...
MINTi
Q9NP72

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1206
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9NP72

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9NP72

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi37 – 45Effector regionBy similarity9

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0080 Eukaryota
ENOG410XPD0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157325

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233968

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NP72

KEGG Orthology (KO)

More...
KOi
K07910

Identification of Orthologs from Complete Genome Data

More...
OMAi
MQSTVGM

Database of Orthologous Groups

More...
OrthoDBi
1247169at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NP72

TreeFam database of animal gene trees

More...
TreeFami
TF313448

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027417 P-loop_NTPase
IPR025662 Sigma_54_int_dom_ATP-bd_1
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00071 Ras, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00231 small_GTP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51419 RAB, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9NP72-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDEDVLTTLK ILIIGESGVG KSSLLLRFTD DTFDPELAAT IGVDFKVKTI
60 70 80 90 100
SVDGNKAKLA IWDTAGQERF RTLTPSYYRG AQGVILVYDV TRRDTFVKLD
110 120 130 140 150
NWLNELETYC TRNDIVNMLV GNKIDKENRE VDRNEGLKFA RKHSMLFIEA
160 170 180 190 200
SAKTCDGVQC AFEELVEKII QTPGLWESEN QNKGVKLSHR EEGQGGGACG

GYCSVL
Length:206
Mass (Da):22,977
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD1B0F4866547DF77
GO
Isoform 2 (identifier: Q9NP72-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-62: W → WVTLHQQTANFFLKSQIGNSPILKWAMWQY

Note: Highly expressed in testis.
Show »
Length:235
Mass (Da):26,410
Checksum:i3E11FA232CFEDCFF
GO
Isoform 3 (identifier: Q9NP72-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-126: Missing.

Note: No experimental confirmation available.
Show »
Length:142
Mass (Da):15,508
Checksum:i9B8066F80314F7A0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y6T8H0Y6T8_HUMAN
Ras-related protein Rab-18
RAB18
291Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X163A0A087X163_HUMAN
Ras-related protein Rab-18
RAB18
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5W0J0Q5W0J0_HUMAN
Ras-related protein Rab-18
RAB18
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61I → L in BAD96873 (Ref. 11) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06649524L → Q in WARBM3. 1 PublicationCorresponds to variant dbSNP:rs387906832EnsemblClinVar.1
Natural variantiVAR_06649693Missing in WARBM3. 1 Publication1
Natural variantiVAR_051713113N → S. Corresponds to variant dbSNP:rs12268932Ensembl.1
Natural variantiVAR_034432198A → T. Corresponds to variant dbSNP:rs11015859EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04391262W → WVTLHQQTANFFLKSQIGNS PILKWAMWQY in isoform 2. 1 Publication1
Alternative sequenceiVSP_04488363 – 126Missing in isoform 3. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ277145
, AJ277146, AJ277147, AJ277148, AJ277149 Genomic DNA Translation: CAB86486.1
AF137372 mRNA Translation: AAF61433.1
AY574034 mRNA Translation: AAU08232.1
AF087860 mRNA Translation: AAP97170.1
AF498950 mRNA Translation: AAM21098.1
AF136974 mRNA Translation: AAG49435.1
AL136734 mRNA Translation: CAB66668.1
BT009840 mRNA Translation: AAP88842.1
CR533455 mRNA Translation: CAG38486.1
AK001555 mRNA Translation: BAG50939.1
AK295443 mRNA Translation: BAH12069.1
AK223153 mRNA Translation: BAD96873.1
AL138920 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86054.1
CH471072 Genomic DNA Translation: EAW86055.1
BC015014 mRNA Translation: AAH15014.1
BC029350 mRNA Translation: AAH29350.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58073.1 [Q9NP72-3]
CCDS7155.1 [Q9NP72-1]
CCDS73081.1 [Q9NP72-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001243339.1, NM_001256410.1 [Q9NP72-2]
NP_001243340.1, NM_001256411.1
NP_001243341.1, NM_001256412.1 [Q9NP72-3]
NP_001243344.1, NM_001256415.1
NP_067075.1, NM_021252.4 [Q9NP72-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000356940; ENSP00000349415; ENSG00000099246 [Q9NP72-1]
ENST00000535776; ENSP00000439321; ENSG00000099246 [Q9NP72-3]
ENST00000621805; ENSP00000478479; ENSG00000099246 [Q9NP72-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22931

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22931

UCSC genome browser

More...
UCSCi
uc001itv.5 human [Q9NP72-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277145
, AJ277146, AJ277147, AJ277148, AJ277149 Genomic DNA Translation: CAB86486.1
AF137372 mRNA Translation: AAF61433.1
AY574034 mRNA Translation: AAU08232.1
AF087860 mRNA Translation: AAP97170.1
AF498950 mRNA Translation: AAM21098.1
AF136974 mRNA Translation: AAG49435.1
AL136734 mRNA Translation: CAB66668.1
BT009840 mRNA Translation: AAP88842.1
CR533455 mRNA Translation: CAG38486.1
AK001555 mRNA Translation: BAG50939.1
AK295443 mRNA Translation: BAH12069.1
AK223153 mRNA Translation: BAD96873.1
AL138920 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86054.1
CH471072 Genomic DNA Translation: EAW86055.1
BC015014 mRNA Translation: AAH15014.1
BC029350 mRNA Translation: AAH29350.1
CCDSiCCDS58073.1 [Q9NP72-3]
CCDS7155.1 [Q9NP72-1]
CCDS73081.1 [Q9NP72-2]
RefSeqiNP_001243339.1, NM_001256410.1 [Q9NP72-2]
NP_001243340.1, NM_001256411.1
NP_001243341.1, NM_001256412.1 [Q9NP72-3]
NP_001243344.1, NM_001256415.1
NP_067075.1, NM_021252.4 [Q9NP72-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X3SX-ray1.32A1-182[»]
SMRiQ9NP72
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116591, 39 interactors
DIPiDIP-60514N
IntActiQ9NP72, 37 interactors
MINTiQ9NP72

PTM databases

iPTMnetiQ9NP72
PhosphoSitePlusiQ9NP72
SwissPalmiQ9NP72

Polymorphism and mutation databases

BioMutaiRAB18
DMDMi12230528

Proteomic databases

EPDiQ9NP72
jPOSTiQ9NP72
MassIVEiQ9NP72
MaxQBiQ9NP72
PaxDbiQ9NP72
PeptideAtlasiQ9NP72
PRIDEiQ9NP72
ProteomicsDBi6488
81906 [Q9NP72-1]
81907 [Q9NP72-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
22931
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356940; ENSP00000349415; ENSG00000099246 [Q9NP72-1]
ENST00000535776; ENSP00000439321; ENSG00000099246 [Q9NP72-3]
ENST00000621805; ENSP00000478479; ENSG00000099246 [Q9NP72-2]
GeneIDi22931
KEGGihsa:22931
UCSCiuc001itv.5 human [Q9NP72-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22931
DisGeNETi22931

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RAB18
GeneReviewsiRAB18
HGNCiHGNC:14244 RAB18
HPAiHPA025928
MalaCardsiRAB18
MIMi602207 gene
614222 phenotype
neXtProtiNX_Q9NP72
OpenTargetsiENSG00000099246
Orphaneti2510 Micro syndrome
PharmGKBiPA34106

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0080 Eukaryota
ENOG410XPD0 LUCA
GeneTreeiENSGT00940000157325
HOGENOMiHOG000233968
InParanoidiQ9NP72
KOiK07910
OMAiMQSTVGM
OrthoDBi1247169at2759
PhylomeDBiQ9NP72
TreeFamiTF313448

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation
R-HSA-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-HSA-8873719 RAB geranylgeranylation
R-HSA-8876198 RAB GEFs exchange GTP for GDP on RABs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RAB18 human
EvolutionaryTraceiQ9NP72

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RAB18

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22931

Pharos

More...
Pharosi
Q9NP72

Protein Ontology

More...
PROi
PR:Q9NP72

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000099246 Expressed in 202 organ(s), highest expression level in metanephros
ExpressionAtlasiQ9NP72 baseline and differential
GenevisibleiQ9NP72 HS

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR025662 Sigma_54_int_dom_ATP-bd_1
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF00071 Ras, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51419 RAB, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRAB18_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NP72
Secondary accession number(s): B3KMC7
, B7Z333, D3DRW1, Q53FX8, Q56UN9, Q6FIH1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: October 1, 2000
Last modified: September 18, 2019
This is version 193 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again