Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (12 Aug 2020)
Sequence version 2 (04 Jan 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein chiffon

Gene

chif

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in initiation of DNA replication; activation of the chorion gene origins. May have a role in eye and thoracic bristle development.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri307 – 356DBF4-typePROSITE-ProRule annotationAdd BLAST50
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi493 – 505A.T hookAdd BLAST13

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, DNA-binding
Biological processDNA replication
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-176187, Activation of ATR in response to replication stress
R-DME-68962, Activation of the pre-replicative complex

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein chiffon
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:chif
ORF Names:CG5813
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0000307, chif

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000896441 – 1711Protein chiffonAdd BLAST1711

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei306Phosphoserine1 Publication1
Modified residuei307Phosphoserine1 Publication1
Modified residuei406Phosphoserine1 Publication1
Modified residuei407Phosphoserine1 Publication1
Modified residuei417Phosphoserine1 Publication1
Modified residuei432Phosphoserine1 Publication1
Modified residuei435Phosphoserine1 Publication1
Modified residuei467Phosphoserine1 Publication1
Modified residuei542Phosphoserine1 Publication1
Modified residuei543Phosphoserine1 Publication1
Modified residuei544Phosphoserine1 Publication1
Modified residuei1081Phosphothreonine1 Publication1
Modified residuei1091Phosphoserine1 Publication1
Modified residuei1092Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NK54

PRoteomics IDEntifications database

More...
PRIDEi
Q9NK54

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9NK54

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed both maternally and zygotically.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0000307, Expressed in cleaving embryo and 56 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NK54, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NK54, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
60983, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q9NK54, 4 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0080396

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1393 – 1410Thr-richAdd BLAST18
Compositional biasi1456 – 1516Glu-richAdd BLAST61

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri307 – 356DBF4-typePROSITE-ProRule annotationAdd BLAST50

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4139, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063909

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_237730_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NK54

Identification of Orthologs from Complete Genome Data

More...
OMAi
YAPPNNG

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9NK54

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.160.680, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006572, Znf_DBF
IPR038545, Znf_DBF_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07535, zf-DBF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00586, ZnF_DBF, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51265, ZF_DBF4, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q9NK54-1) [UniParc]FASTAAdd to basket
Also known as: 1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQPQSDKQSA SRLATTTSHS TAAASATAAT PPKVKVIKSK RPLCHFKFYL
60 70 80 90 100
DICDHQLAKR IESDIKALGG HLEFFLSDDI THFVTDKPEV IGGTSGTPGT
110 120 130 140 150
PSTPGTPTSH YQQNDGSARK PNQRQSRADA ILSRVRRSTV GVVNSGNSTP
160 170 180 190 200
TTSLKRSYTI WQTDYAQRFI KRIQTELKQY LEGKKEGGGG STSASPHHIQ
210 220 230 240 250
LKKQYVKIES VKRNYRPYYH LIKQPDDWPK IDLSSEDGAF RLLTKSKTKD
260 270 280 290 300
KEHSMTRKPL GSRTSQKDKQ AAGEAKPLQH PSLQELKKQS AIPNSPRSNC
310 320 330 340 350
REPIDSSEKQ GGVCEICKLE YDILNIHLQS KDHELFAKNS DNFLALDTLI
360 370 380 390 400
QSSADVNRFL EEEPVESELD MDVDESLSNE ELQSPRQRPS PALREKSKRI
410 420 430 440 450
TKGKHSSEKF QGVAVASPQT PFPGAKKVQG NSPGSLSELQ RQEHPTTAAA
460 470 480 490 500
TPTTNSGRRK TQNSGLSPPK RAMLPPSSIY KVVETREECA TPPRGRGRPP
510 520 530 540 550
NQVDSPSLIV KFQKIRQTEL QRLNGEAENF MFPRTAVPTT RSSSELPTDV
560 570 580 590 600
DRQTTSDVRG RYSISSASLD TSTSEAETKE SSGLPTSIRK RAQAVGRRRK
610 620 630 640 650
VGGAAAQDVF QRQLSTGSSS SNSNQQRFPS APIQPEEGPQ PQPKPQLKIK
660 670 680 690 700
IKQEQLVATR KSSRTATAIV TAATASSHQQ QQLRQTTCRK MANKLEDRMG
710 720 730 740 750
ELVKPKIKIK KEVIEEQKVK ELEDLEEILD KELDEEVDSS CSSGSDEDYI
760 770 780 790 800
AGSQRRITAA PRKSTDTREQ RAARRLSRLT INRSAGELEL TEVKTSPSKS
810 820 830 840 850
RTKIQKPSSP TKNKVKQTKA VPPAIDLFFD CSKSERLREM QYTFESLPSG
860 870 880 890 900
ELWNRVFLRQ DAGEENYYTY YGSTNYRKLP YEMGPIPMAK TLPAHSCALC
910 920 930 940 950
REASEVKQDK GEQIKLEDQK PAPKKEVKKE EEVQSSSSSA TYKNKKLHLL
960 970 980 990 1000
QRYQQEQEQL QQLEGNSLAT AGAKCDSKAS TPELLEREFA SGSMGDRVQL
1010 1020 1030 1040 1050
IERVRSTSSS SCSNSQRSGI TCRNKQLARI AELPPRKSPR EHASTLALVS
1060 1070 1080 1090 1100
CIIRQRQDSQ SKTNSEAEEP PPPVAAPKLK TPIKQEPVAP SSPRTTRSQA
1110 1120 1130 1140 1150
ATPVEELRFA TEISETVKRM RRGQNKYDHS PPAPVPTPAT SSPVRSRRLT
1160 1170 1180 1190 1200
PAARNQSQIY SRRLEFATSQ RESSASALLG KRKRRVNPSV AGTVRPTTQN
1210 1220 1230 1240 1250
LPGTGAYRGV RKLPSKKGLL EYEMETCALK ALDQARQYCN PGFVAWQLDK
1260 1270 1280 1290 1300
YLELAGKEYD IEFDQISPEV ESEGREERLV NTPQTPPPTD CFTSEFDLCD
1310 1320 1330 1340 1350
LIMGSAGSGD DDEDVSRGNP PGSGRRMSNL NLYASYYRKR KSLKSNRTGW
1360 1370 1380 1390 1400
PKAQRRRNAG GLGGSRALPD ERINFQKMGL AELHPIKQEP METEEEQTTT
1410 1420 1430 1440 1450
TTTTTTTSAT RGNLLSKDDE DDEGGGNSPS GGSPADDKQN SREDAVMTPP
1460 1470 1480 1490 1500
ATDVDEQAEP QADEMESLPD EDETMADSVD QQQDVEAEIE ATDADVEEEE
1510 1520 1530 1540 1550
EEEDEDEDVF EDAYEEQDMG IQKTEPHEKR ARIPSISVTT PPEDSSQGKK
1560 1570 1580 1590 1600
LLLTLHNGQR LQATSTPSTG QVQQHQRRTP QLNGSLGSCI SPSEKLGDNS
1610 1620 1630 1640 1650
DIFTVSSDGL DTDLDLSNTQ AGDSHEHCPH QTTPKRKFDI SKYAPPNSGK
1660 1670 1680 1690 1700
AASSCAAEAA TAAVKSLAIS QFLKKETCAS SSSMRNAWRR TQRRAISAAC
1710
ISAAPSARVP N
Length:1,711
Mass (Da):189,218
Last modified:January 4, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CF179D974817BDA
GO
Isoform B (identifier: Q9NK54-2) [UniParc]FASTAAdd to basket
Also known as: 2

The sequence of this isoform differs from the canonical sequence as follows:
     1677-1711: TCASSSSMRNAWRRTQRRAISAACISAAPSARVPN → VRVTCRRLRAPFRRFRYRR

Show »
Length:1,695
Mass (Da):188,048
Checksum:iB3E85B35C3DA4FA0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9PD16M9PD16_DROME
Chiffon, isoform D
chif BG:DS09218.1, BG:DS09218.2, CG5817, chf, Chif
1,695Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A6H2EHD1A0A6H2EHD1_DROME
Chiffon, isoform E
chif BG:DS09218.1, BG:DS09218.2, CG5813, CG5817, chf
576Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL28467 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti709I → K in AAM50251 (PubMed:12537569).Curated1
Sequence conflicti712E → K in AAM50251 (PubMed:12537569).Curated1
Sequence conflicti837L → F in AAD48779 (PubMed:10477296).Curated1
Sequence conflicti837L → F in AAD48780 (PubMed:10477296).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0124071677 – 1711TCASS…ARVPN → VRVTCRRLRAPFRRFRYRR in isoform B. 2 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF158178 mRNA Translation: AAD48779.1
AF158179 mRNA Translation: AAD48780.1
AE014134 Genomic DNA Translation: AAF53530.1
AE014134 Genomic DNA Translation: AAG22437.1
AY060919 mRNA Translation: AAL28467.1 Different initiation.
AY119597 mRNA Translation: AAM50251.1

NCBI Reference Sequences

More...
RefSeqi
NP_001260499.1, NM_001273570.2 [Q9NK54-2]
NP_523583.2, NM_078859.4 [Q9NK54-1]
NP_723965.1, NM_165156.3 [Q9NK54-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0080838; FBpp0080396; FBgn0000307 [Q9NK54-1]
FBtr0080839; FBpp0080397; FBgn0000307 [Q9NK54-2]
FBtr0321313; FBpp0302856; FBgn0000307 [Q9NK54-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
34974

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG5813

UCSC genome browser

More...
UCSCi
CG5813-RA, d. melanogaster [Q9NK54-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF158178 mRNA Translation: AAD48779.1
AF158179 mRNA Translation: AAD48780.1
AE014134 Genomic DNA Translation: AAF53530.1
AE014134 Genomic DNA Translation: AAG22437.1
AY060919 mRNA Translation: AAL28467.1 Different initiation.
AY119597 mRNA Translation: AAM50251.1
RefSeqiNP_001260499.1, NM_001273570.2 [Q9NK54-2]
NP_523583.2, NM_078859.4 [Q9NK54-1]
NP_723965.1, NM_165156.3 [Q9NK54-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi60983, 4 interactors
IntActiQ9NK54, 4 interactors
STRINGi7227.FBpp0080396

PTM databases

iPTMnetiQ9NK54

Proteomic databases

PaxDbiQ9NK54
PRIDEiQ9NK54

Genome annotation databases

EnsemblMetazoaiFBtr0080838; FBpp0080396; FBgn0000307 [Q9NK54-1]
FBtr0080839; FBpp0080397; FBgn0000307 [Q9NK54-2]
FBtr0321313; FBpp0302856; FBgn0000307 [Q9NK54-2]
GeneIDi34974
KEGGidme:Dmel_CG5813
UCSCiCG5813-RA, d. melanogaster [Q9NK54-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
34974
FlyBaseiFBgn0000307, chif

Phylogenomic databases

eggNOGiKOG4139, Eukaryota
GeneTreeiENSGT00530000063909
HOGENOMiCLU_237730_0_0_1
InParanoidiQ9NK54
OMAiYAPPNNG
PhylomeDBiQ9NK54

Enzyme and pathway databases

ReactomeiR-DME-176187, Activation of ATR in response to replication stress
R-DME-68962, Activation of the pre-replicative complex

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
34974, 1 hit in 5 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
chif, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
34974

Protein Ontology

More...
PROi
PR:Q9NK54

Gene expression databases

BgeeiFBgn0000307, Expressed in cleaving embryo and 56 other tissues
ExpressionAtlasiQ9NK54, baseline and differential
GenevisibleiQ9NK54, DM

Family and domain databases

Gene3Di3.30.160.680, 1 hit
InterProiView protein in InterPro
IPR006572, Znf_DBF
IPR038545, Znf_DBF_sf
PfamiView protein in Pfam
PF07535, zf-DBF, 1 hit
SMARTiView protein in SMART
SM00586, ZnF_DBF, 1 hit
PROSITEiView protein in PROSITE
PS51265, ZF_DBF4, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCHIF_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NK54
Secondary accession number(s): Q8MRI8
, Q95S82, Q9NK53, Q9U9R4, Q9U9R5, Q9VJL0, Q9VJL1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: January 4, 2005
Last modified: August 12, 2020
This is version 127 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again