Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (12 Aug 2020)
Sequence version 3 (18 Sep 2013)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-dependent secretion activator

Gene

Cadps

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles. However, it probably also participates in small clear synaptic vesicles (SVs) exocytosis and it is unclear whether its function is related to Ca2+ triggering.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processExocytosis, Protein transport, Transport
LigandCalcium, Lipid-binding, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-dependent secretion activator
Alternative name(s):
Calcium-activated protein for secretion
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CadpsImported
Synonyms:CapsImported
ORF Names:CG33653Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0053653, Cadps

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Flies display locomotory deficits and complete embryonic lethality. The mutant NMJ reveals a 50% loss in evoked glutamatergic transmission, and an accumulation of synaptic vesicles at active zones. They also display a 3-fold accumulation of DCVs in synaptic terminals.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000538721 – 1447Calcium-dependent secretion activatorAdd BLAST1447

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9NHE5

PRoteomics IDEntifications database

More...
PRIDEi
Q9NHE5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Restricted to the nervous system at all stages of development and highly localized at synapses (at protein level).1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Not detected in early embryos through stage 8. Strongly expressed in neural-specific cells at the onset of early stages of neuronal differentiation beginning at stage 9-10. Accumulates from stage 12 through the rest of embryogenesis in all neuronal cells within the brain and ventral nerve cord (VNC). Remains restricted to the central nervous system and not detected in other tissues at any stage of development.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0053653, Expressed in brain and 36 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9NHE5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9NHE5, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
72491, 1 interactor

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0298334

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini417 – 547C2PROSITE-ProRule annotationAdd BLAST131
Domaini573 – 683PHPROSITE-ProRule annotationAdd BLAST111
Domaini970 – 1157MHD1PROSITE-ProRule annotationAdd BLAST188

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids.By similarity

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3543, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00590000083094

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9NHE5

KEGG Orthology (KO)

More...
KOi
K19933

Identification of Orthologs from Complete Genome Data

More...
OMAi
YISADPC

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033227, CAPS
IPR010439, CAPS_dom
IPR014770, Munc13_1
IPR011993, PH-like_dom_sf
IPR001849, PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR12166, PTHR12166, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06292, DUF1041, 1 hit
PF00169, PH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01145, DUF1041, 1 hit
SM00233, PH, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004, C2, 1 hit
PS51258, MHD1, 1 hit
PS50003, PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9NHE5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIDPSSSEEE GEDDAVPNVS SKGRLTNTTK GTSAVSIIGG SAGSVVGSNI
60 70 80 90 100
PVSGSNTDLI GNQRQSNISS ICNRNDVGNI SVAALGSTSN KIEQICGNRA
110 120 130 140 150
DTGNLEVPSN GIPSGISQET LNQSVGSSRA NSLPRPLSPS PSLTSEKHET
160 170 180 190 200
AEPHGKHERE EEERKRRIQL YVFISRCISY PFNAKQPTDM TKRQTKISKQ
210 220 230 240 250
QLEIITQRFQ AFLKGETQIM ADEAFQNAVQ SYHDVFLKSE RVLKMVQSGA
260 270 280 290 300
SSQHDFREVF RNNIEKRVRS LPEIDGLSKE TVLTSWMAKF DIILKGTGEE
310 320 330 340 350
DSKRPSRMQQ SLNSELILSK EQLYDMFQQI LLVKKFEHQI LFNALMLDSA
360 370 380 390 400
DEQAAAIRRE LDGRMQRVGE MEKNRKLMPK FVLKEMESLY VEELKSSINL
410 420 430 440 450
LMANLESLPV SKGNMDSKYG LQKLKRYNHS TPSFLKLILR SHGSLSKLEG
460 470 480 490 500
DSEDGSTQLT KLDVVLTFQL EVIVMEVENG EKLQTDQAEA SKPMWDTQGD
510 520 530 540 550
FTTTHPLPVV KVKLYTENPG MLALEDKELG KVTLKPTPLS SKSPEWHRMI
560 570 580 590 600
VPKNLPDQDI RIKIACRLDK PLNMKHCGYL YAIGKSVWKK WKRRYFVLVQ
610 620 630 640 650
VSQYTFAMCS YKEKKSEPSE MMQLDGYTVD YIEAASANLM FGIDLNGGRY
660 670 680 690 700
FFNAVREGDS ISFACDDENE CSLWVMAMYR ATGQSHKPTP PITQDKNSAM
710 720 730 740 750
SKIQGDADKA RKHGMEDFIS TDPCTFDHAT LFKTLQNLTL EYRLNDPYAS
760 770 780 790 800
LGWFSPGQVF VLDEYCARYG VRGCYRHLCY LSDLLDRAEK QHMIDPTLIH
810 820 830 840 850
YSFAFCASHV HGNRPDGVGS ITHEEKEKFS EIKERLRQLL EFQITNFRYC
860 870 880 890 900
FPFGRPEGAL KATLSLLERV LMKDIVTPVP PEEVRQMIKK SLETAALVNY
910 920 930 940 950
TRLSNKAKID EDLRGDVIVP APKKLEDLIH LAELCVDLLQ QNEEHYGEAF
960 970 980 990 1000
AWFSDLLVEH AEIFWSLFAV DMDRVLSEQA PDTWDSFPLF QILNDYLRTD
1010 1020 1030 1040 1050
DNLRNGRFHQ HLRDTFAPLV VRYVDLMESS IAQSIHKGFE KERWESKGIN
1060 1070 1080 1090 1100
AALNPAALNN AAQALNTAAL NPSMILCGKK DQVNFYVPKL PKQSNSTAAN
1110 1120 1130 1140 1150
DEMRNGCATS EDLFWKLDAL QSFIRDLHWP DAEFRQHLEQ RLKMMAVDMI
1160 1170 1180 1190 1200
EQCIQRTDSS FQSWLKKNIA FISTDYILPS EMCAMVNVIL DAKNQSFKLT
1210 1220 1230 1240 1250
TIDGIDLYKF HAKIDDQIDK ANVAMTQGLS GKLMSVLEST LSKLARYDEG
1260 1270 1280 1290 1300
SLIGSILSFT NVSSSGKDLG QGYVNFFRNN MDQVRGKIAD DLWTLHFFEQ
1310 1320 1330 1340 1350
WYSQQINMLC NWLSERVDHA LHYAQVASIS HIIKKIYSDF ELQGVLEDKL
1360 1370 1380 1390 1400
NSKAYQAVAQ RMATEEATCA LTMPDACEDE PCDEIREGEE EDNGDESTSN
1410 1420 1430 1440
IPRGLPKPKV AAAQAAAVTN VVAGRVGNLL GKGIGGLSSK LGSGSWF
Length:1,447
Mass (Da):163,110
Last modified:September 18, 2013 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i406B95DC0ECEE996
GO
Isoform 2 (identifier: Q9NHE5-2) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     477-477: V → VKGLKSLAPNRIVYCTMEV
     948-948: E → ELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPT

Show »
Length:1,534
Mass (Da):172,589
Checksum:iFAEC538101F31CC6
GO
Isoform 3 (identifier: Q9NHE5-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-463: Missing.
     477-477: V → VKGLKSLAPNRIVYCTMEV
     948-948: E → ELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPT
     1001-1053: DNLRNGRFHQ...WESKGINAAL → APTQAPLSAT...LFSKPTRIAP
     1054-1447: Missing.

Note: Incomplete sequence.Curated
Show »
Length:677
Mass (Da):76,634
Checksum:i1C7A497136561B0F
GO
Isoform 4 (identifier: Q9NHE5-4) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     477-478: Missing.

Show »
Length:1,445
Mass (Da):162,882
Checksum:i9146A557098B2AAC
GO
Isoform 5 (identifier: Q9NHE5-5) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     430-435: STPSFL → R
     477-477: V → VKGLKSLAPNRIVYCTMEV
     948-948: E → ELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPT

Show »
Length:1,529
Mass (Da):172,113
Checksum:i90516BA213153A91
GO
Isoform 6 (identifier: Q9NHE5-6) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     477-477: V → VKGLKSLAPNRIVYCTMEV
     705-705: Missing.
     948-948: E → ELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPT
     1049-1104: Missing.

Show »
Length:1,477
Mass (Da):166,622
Checksum:iCCB2F97873EF3EC5
GO
Isoform 7 (identifier: Q9NHE5-7) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     477-477: V → VKGLKSLAPNRIVYCTMEV
     1049-1104: Missing.

Show »
Length:1,409
Mass (Da):159,205
Checksum:i42A765A91A2DF5F7
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD38612 differs from that shown.Curated
The sequence AAF34697 differs from that shown. Reason: Frameshift.Curated
The sequence AAM48456 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti33S → N in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti153P → Q in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti164R → S in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti168 – 171IQLY → NSTL in AAF34697 (PubMed:11516399).Curated4
Sequence conflicti195T → K in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti204I → N in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti1234M → V in AAF34697 (PubMed:11516399).Curated1
Sequence conflicti1354 – 1358AYQAV → DIRQ in AAF34697 (PubMed:11516399).Curated5

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0479121 – 463Missing in isoform 3. 1 PublicationAdd BLAST463
Alternative sequenceiVSP_047913430 – 435STPSFL → R in isoform 5. Curated6
Alternative sequenceiVSP_047914477 – 478Missing in isoform 4. Curated2
Alternative sequenceiVSP_047915477V → VKGLKSLAPNRIVYCTMEV in isoform 2, isoform 3, isoform 5, isoform 6 and isoform 7. 2 Publications1
Alternative sequenceiVSP_047916705Missing in isoform 6. Curated1
Alternative sequenceiVSP_047917948E → ELRKHDKMDKKKLLKEDEDV SGGHNESEVDLIDSTGLISA SELATAASTDGSSFRYCMPT HAVYTPPVPT in isoform 2, isoform 3, isoform 5 and isoform 6. 2 Publications1
Alternative sequenceiVSP_0479181001 – 1053DNLRN…INAAL → APTQAPLSATTTGAIPTARS TSGWVRVHQGTAPLTPSKTN PEVLFSKPTRIAP in isoform 3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_0479191049 – 1104Missing in isoform 6 and isoform 7. CuratedAdd BLAST56
Alternative sequenceiVSP_0479201054 – 1447Missing in isoform 3. 1 PublicationAdd BLAST394

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF223578 mRNA Translation: AAF34697.1 Frameshift.
AE014135 Genomic DNA Translation: AAN06590.4
AE014135 Genomic DNA Translation: AAN06591.4
AE014135 Genomic DNA Translation: AAZ52485.2
AE014135 Genomic DNA Translation: AFH06799.1
AE014135 Genomic DNA Translation: AFH06800.1
AY118427 mRNA Translation: AAM48456.1 Different initiation.
AF145637 mRNA Translation: AAD38612.1 Sequence problems.

NCBI Reference Sequences

More...
RefSeqi
NP_001027029.2, NM_001031858.2 [Q9NHE5-7]
NP_001027030.1, NM_001031859.2 [Q9NHE5-4]
NP_001027031.1, NM_001031860.2 [Q9NHE5-5]
NP_001245439.1, NM_001258510.2 [Q9NHE5-2]
NP_001245440.1, NM_001258511.2 [Q9NHE5-6]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0091630; FBpp0088329; FBgn0053653 [Q9NHE5-5]
FBtr0091631; FBpp0088330; FBgn0053653 [Q9NHE5-4]
FBtr0307333; FBpp0298334; FBgn0053653 [Q9NHE5-2]
FBtr0307334; FBpp0298335; FBgn0053653 [Q9NHE5-6]
FBtr0333702; FBpp0305855; FBgn0053653 [Q9NHE5-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
49968

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG33653

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF223578 mRNA Translation: AAF34697.1 Frameshift.
AE014135 Genomic DNA Translation: AAN06590.4
AE014135 Genomic DNA Translation: AAN06591.4
AE014135 Genomic DNA Translation: AAZ52485.2
AE014135 Genomic DNA Translation: AFH06799.1
AE014135 Genomic DNA Translation: AFH06800.1
AY118427 mRNA Translation: AAM48456.1 Different initiation.
AF145637 mRNA Translation: AAD38612.1 Sequence problems.
RefSeqiNP_001027029.2, NM_001031858.2 [Q9NHE5-7]
NP_001027030.1, NM_001031859.2 [Q9NHE5-4]
NP_001027031.1, NM_001031860.2 [Q9NHE5-5]
NP_001245439.1, NM_001258510.2 [Q9NHE5-2]
NP_001245440.1, NM_001258511.2 [Q9NHE5-6]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi72491, 1 interactor
STRINGi7227.FBpp0298334

Proteomic databases

PaxDbiQ9NHE5
PRIDEiQ9NHE5

Genome annotation databases

EnsemblMetazoaiFBtr0091630; FBpp0088329; FBgn0053653 [Q9NHE5-5]
FBtr0091631; FBpp0088330; FBgn0053653 [Q9NHE5-4]
FBtr0307333; FBpp0298334; FBgn0053653 [Q9NHE5-2]
FBtr0307334; FBpp0298335; FBgn0053653 [Q9NHE5-6]
FBtr0333702; FBpp0305855; FBgn0053653 [Q9NHE5-7]
GeneIDi49968
KEGGidme:Dmel_CG33653

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8618
FlyBaseiFBgn0053653, Cadps

Phylogenomic databases

eggNOGiKOG3543, Eukaryota
GeneTreeiENSGT00590000083094
InParanoidiQ9NHE5
KOiK19933
OMAiYISADPC

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
49968, 0 hits in 5 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Cadps, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
49968

Protein Ontology

More...
PROi
PR:Q9NHE5

Gene expression databases

BgeeiFBgn0053653, Expressed in brain and 36 other tissues
ExpressionAtlasiQ9NHE5, baseline and differential
GenevisibleiQ9NHE5, DM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR033227, CAPS
IPR010439, CAPS_dom
IPR014770, Munc13_1
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
PANTHERiPTHR12166, PTHR12166, 1 hit
PfamiView protein in Pfam
PF06292, DUF1041, 1 hit
PF00169, PH, 1 hit
SMARTiView protein in SMART
SM01145, DUF1041, 1 hit
SM00233, PH, 1 hit
PROSITEiView protein in PROSITE
PS50004, C2, 1 hit
PS51258, MHD1, 1 hit
PS50003, PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAPS_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9NHE5
Secondary accession number(s): H9XVQ4
, H9XVQ5, Q4AB01, Q5LJP1, Q8IM88, Q8IM89, Q8MT21, Q9Y135
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: September 18, 2013
Last modified: August 12, 2020
This is version 134 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again