Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (13 Feb 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

ABSCISIC ACID-INSENSITIVE 5-like protein 6

Gene

ABF3

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to the ABA-responsive element (ABRE). Mediates stress-responsive ABA signaling.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processAbscisic acid signaling pathway, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ABSCISIC ACID-INSENSITIVE 5-like protein 6
Alternative name(s):
Abscisic acid responsive elements-binding factor 3
Short name:
ABRE-binding factor 3
Dc3 promoter-binding factor 5
Short name:
AtDPBF5
bZIP transcription factor 37
Short name:
AtbZIP37
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABF3
Synonyms:BZIP37, DPBF5
Ordered Locus Names:At4g34000/At4g34010
ORF Names:F17I5.190/F17I5.200, F28A23.230
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT4G34000

The Arabidopsis Information Resource

More...
TAIRi
locus:2118969 AT4G34000

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Defective in ABA and stress responses.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003696111 – 454ABSCISIC ACID-INSENSITIVE 5-like protein 6Add BLAST454

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei32PhosphoserineSequence analysis1
Modified residuei55PhosphoserineBy similarity1
Modified residuei126PhosphoserineBy similarity1
Modified residuei169PhosphothreonineSequence analysis1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9M7Q3

PRoteomics IDEntifications database

More...
PRIDEi
Q9M7Q3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9M7Q3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in roots and flowers.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by drought, salt, abscisic acid (ABA).2 Publications

Gene expression databases

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9M7Q3 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

DNA-binding heterodimer (By similarity). Interacts with ABI3 and the AFP proteins AFP1, AFP2, AFP3 and AFP4.By similarity2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
14829, 22 interactors

Protein interaction database and analysis system

More...
IntActi
Q9M7Q3, 6 interactors

STRING: functional protein association networks

More...
STRINGi
3702.AT4G34000.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9M7Q3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini372 – 435bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni374 – 393Basic motifPROSITE-ProRule annotationAdd BLAST20
Regioni400 – 414Leucine-zipperPROSITE-ProRule annotationAdd BLAST15

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi222 – 269Gln-richAdd BLAST48

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the bZIP family. ABI5 subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFYJ Eukaryota
ENOG410YB2M LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000237278

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9M7Q3

KEGG Orthology (KO)

More...
KOi
K14432

Identification of Orthologs from Complete Genome Data

More...
OMAi
RKQVEIM

Database of Orthologous Groups

More...
OrthoDBi
822545at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9M7Q3

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004827 bZIP

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00170 bZIP_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00338 BRLZ, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9M7Q3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSRLNFKSF VDGVSEQQPT VGTSLPLTRQ NSVFSLTFDE FQNSWGGGIG
60 70 80 90 100
KDFGSMNMDE LLKNIWTAEE SHSMMGNNTS YTNISNGNSG NTVINGGGNN
110 120 130 140 150
IGGLAVGVGG ESGGFFTGGS LQRQGSLTLP RTISQKRVDD VWKELMKEDD
160 170 180 190 200
IGNGVVNGGT SGIPQRQQTL GEMTLEEFLV RAGVVREEPQ PVESVTNFNG
210 220 230 240 250
GFYGFGSNGG LGTASNGFVA NQPQDLSGNG VAVRQDLLTA QTQPLQMQQP
260 270 280 290 300
QMVQQPQMVQ QPQQLIQTQE RPFPKQTTIA FSNTVDVVNR SQPATQCQEV
310 320 330 340 350
KPSILGIHNH PMNNNLLQAV DFKTGVTVAA VSPGSQMSPD LTPKSALDAS
360 370 380 390 400
LSPVPYMFGR VRKTGAVLEK VIERRQKRMI KNRESAARSR ARKQAYTMEL
410 420 430 440 450
EAEIAQLKEL NEELQKKQVE IMEKQKNQLL EPLRQPWGMG CKRQCLRRTL

TGPW
Length:454
Mass (Da):49,677
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB0428D39183374EF
GO
Isoform 2 (identifier: Q9M7Q3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     420-454: EIMEKQKNQLLEPLRQPWGMGCKRQCLRRTLTGPW → CLASSLSQLRISRFSYFLEVVFTDQMFHAG

Note: May be due to intron retention. No experimental confirmation available.
Show »
Length:449
Mass (Da):48,905
Checksum:i79B7B6B4739872B9
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA17571 differs from that shown. Reason: Erroneous gene model prediction. Was originally thought to correspond to two different genes At4g34000 and At4g34010.Curated
The sequence CAA19882 differs from that shown. Reason: Erroneous gene model prediction. Was originally thought to correspond to two different genes At4g34000 and At4g34010.Curated
The sequence CAA19883 differs from that shown. Reason: Erroneous gene model prediction. Was originally thought to correspond to two different genes At4g34000 and At4g34010.Curated
The sequence CAB80117 differs from that shown. Reason: Erroneous gene model prediction. Was originally thought to correspond to two different genes At4g34000 and At4g34010.Curated
The sequence CAB80118 differs from that shown. Reason: Erroneous gene model prediction. Was originally thought to correspond to two different genes At4g34000 and At4g34010.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_036886420 – 454EIMEK…LTGPW → CLASSLSQLRISRFSYFLEV VFTDQMFHAG in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF093546 mRNA Translation: AAF27181.1
AF334210 mRNA Translation: AAK19603.1
AL021961 Genomic DNA Translation: CAA17571.1 Sequence problems.
AL031032 Genomic DNA Translation: CAA19882.1 Sequence problems.
AL031032 Genomic DNA Translation: CAA19883.1 Sequence problems.
AL161584 Genomic DNA Translation: CAB80117.1 Sequence problems.
AL161584 Genomic DNA Translation: CAB80118.1 Sequence problems.
CP002687 Genomic DNA Translation: AEE86307.1
CP002687 Genomic DNA Translation: AEE86308.1
CP002687 Genomic DNA Translation: AEE86309.1
CP002687 Genomic DNA Translation: ANM67065.1
AY054605 mRNA Translation: AAK96796.1
AY081467 mRNA Translation: AAM10029.1
AK175851 mRNA Translation: BAD43614.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T05228
T05229

NCBI Reference Sequences

More...
RefSeqi
NP_001031785.2, NM_001036708.3 [Q9M7Q3-2]
NP_001320130.1, NM_001342246.1 [Q9M7Q3-1]
NP_567949.1, NM_119562.5 [Q9M7Q3-1]
NP_849490.2, NM_179159.4 [Q9M7Q3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
At.21769

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT4G34000.1; AT4G34000.1; AT4G34000 [Q9M7Q3-1]
AT4G34000.2; AT4G34000.2; AT4G34000 [Q9M7Q3-1]
AT4G34000.3; AT4G34000.3; AT4G34000 [Q9M7Q3-2]
AT4G34000.4; AT4G34000.4; AT4G34000 [Q9M7Q3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
829547

Gramene; a comparative resource for plants

More...
Gramenei
AT4G34000.1; AT4G34000.1; AT4G34000 [Q9M7Q3-1]
AT4G34000.2; AT4G34000.2; AT4G34000 [Q9M7Q3-1]
AT4G34000.3; AT4G34000.3; AT4G34000 [Q9M7Q3-2]
AT4G34000.4; AT4G34000.4; AT4G34000 [Q9M7Q3-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT4G34000

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF093546 mRNA Translation: AAF27181.1
AF334210 mRNA Translation: AAK19603.1
AL021961 Genomic DNA Translation: CAA17571.1 Sequence problems.
AL031032 Genomic DNA Translation: CAA19882.1 Sequence problems.
AL031032 Genomic DNA Translation: CAA19883.1 Sequence problems.
AL161584 Genomic DNA Translation: CAB80117.1 Sequence problems.
AL161584 Genomic DNA Translation: CAB80118.1 Sequence problems.
CP002687 Genomic DNA Translation: AEE86307.1
CP002687 Genomic DNA Translation: AEE86308.1
CP002687 Genomic DNA Translation: AEE86309.1
CP002687 Genomic DNA Translation: ANM67065.1
AY054605 mRNA Translation: AAK96796.1
AY081467 mRNA Translation: AAM10029.1
AK175851 mRNA Translation: BAD43614.1
PIRiT05228
T05229
RefSeqiNP_001031785.2, NM_001036708.3 [Q9M7Q3-2]
NP_001320130.1, NM_001342246.1 [Q9M7Q3-1]
NP_567949.1, NM_119562.5 [Q9M7Q3-1]
NP_849490.2, NM_179159.4 [Q9M7Q3-1]
UniGeneiAt.21769

3D structure databases

ProteinModelPortaliQ9M7Q3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi14829, 22 interactors
IntActiQ9M7Q3, 6 interactors
STRINGi3702.AT4G34000.1

PTM databases

iPTMnetiQ9M7Q3

Proteomic databases

PaxDbiQ9M7Q3
PRIDEiQ9M7Q3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT4G34000.1; AT4G34000.1; AT4G34000 [Q9M7Q3-1]
AT4G34000.2; AT4G34000.2; AT4G34000 [Q9M7Q3-1]
AT4G34000.3; AT4G34000.3; AT4G34000 [Q9M7Q3-2]
AT4G34000.4; AT4G34000.4; AT4G34000 [Q9M7Q3-1]
GeneIDi829547
GrameneiAT4G34000.1; AT4G34000.1; AT4G34000 [Q9M7Q3-1]
AT4G34000.2; AT4G34000.2; AT4G34000 [Q9M7Q3-1]
AT4G34000.3; AT4G34000.3; AT4G34000 [Q9M7Q3-2]
AT4G34000.4; AT4G34000.4; AT4G34000 [Q9M7Q3-1]
KEGGiath:AT4G34000

Organism-specific databases

AraportiAT4G34000
TAIRilocus:2118969 AT4G34000

Phylogenomic databases

eggNOGiENOG410IFYJ Eukaryota
ENOG410YB2M LUCA
HOGENOMiHOG000237278
InParanoidiQ9M7Q3
KOiK14432
OMAiRKQVEIM
OrthoDBi822545at2759
PhylomeDBiQ9M7Q3

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9M7Q3

Gene expression databases

GenevisibleiQ9M7Q3 AT

Family and domain databases

InterProiView protein in InterPro
IPR004827 bZIP
PfamiView protein in Pfam
PF00170 bZIP_1, 1 hit
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit
PS00036 BZIP_BASIC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAI5L6_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9M7Q3
Secondary accession number(s): O49503, O49504, Q9C5Q1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 14, 2009
Last sequence update: October 1, 2000
Last modified: February 13, 2019
This is version 119 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again