Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 179 (12 Aug 2020)
Sequence version 3 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Misshapen-like kinase 1

Gene

Mink1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine kinase which acts as a negative regulator of Ras-related Rap2-mediated signal transduction to control neuronal structure and AMPA receptor trafficking. Required for normal synaptic density, dendrite complexity, as well as surface AMPA receptor expression in hippocampal neurons. Can activate the JNK and MAPK14/p38 pathways and mediates stimulation of the stress-activated protein kinase MAPK14/p38 MAPK downstream of the Raf/ERK pathway. Phosphorylates: TANC1 upon stimulation by RAP2A, MBP and SMAD1. Has an essential function in negative selection of thymocytes, perhaps by coupling NCK1 to activation of JNK1.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei54ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei153Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi31 – 39ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2559580, Oxidative Stress Induced Senescence

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Misshapen-like kinase 1 (EC:2.7.11.1)
Alternative name(s):
GCK family kinase MiNK
MAPK/ERK kinase kinase kinase 6
Short name:
MEK kinase kinase 6
Short name:
MEKKK 6
Misshapen/NIK-related kinase
Mitogen-activated protein kinase kinase kinase kinase 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mink1By similarity
Synonyms:Map4k6Imported, MinkImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1355329, Mink1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000863301 – 1308Misshapen-like kinase 1Add BLAST1308

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei324PhosphoserineCombined sources1
Modified residuei326PhosphoserineCombined sources1
Modified residuei503Omega-N-methylarginineCombined sources1
Modified residuei511Omega-N-methylarginineCombined sources1
Modified residuei644PhosphoserineBy similarity1
Modified residuei720PhosphoserineBy similarity1
Modified residuei729PhosphoserineCombined sources1
Modified residuei745PhosphoserineBy similarity1
Modified residuei746PhosphoserineCombined sources1
Modified residuei750PhosphoserineCombined sources1
Modified residuei867PhosphothreonineCombined sources1
Isoform 31 Publication (identifier: Q9JM52-3)
Modified residuei702PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autophosphorylated.By similarity

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9JM52

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9JM52

PeptideAtlas

More...
PeptideAtlasi
Q9JM52

PRoteomics IDEntifications database

More...
PRIDEi
Q9JM52

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9JM52

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9JM52

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Appears to be ubiquitous, expressed in all tissue types examined. Highly expressed in the brain, moderately expressed in kidney and spleen, low levels present in heart and skeletal muscle. Isoform 2 is more abundant in the brain than isoform 1.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Up-regulated during postnatal brain development.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000020827, Expressed in visual cortex and 273 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9JM52, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9JM52, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAP2A and TANC1 (By similarity).

Interacts with NCK1.

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
206164, 11 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9JM52

Protein interaction database and analysis system

More...
IntActi
Q9JM52, 8 interactors

Molecular INTeraction database

More...
MINTi
Q9JM52

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000072649

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9JM52, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9JM52

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 289Protein kinasePROSITE-ProRule annotationAdd BLAST265
Domaini995 – 1282CNHPROSITE-ProRule annotationAdd BLAST288

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni842 – 1308Mediates interaction with RAP2ABy similarityAdd BLAST467

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi359 – 497Gln-richAdd BLAST139
Compositional biasi544 – 672Pro-richAdd BLAST129
Compositional biasi800 – 803Poly-Ser4
Compositional biasi810 – 815Poly-Glu6

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0587, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183196

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001831_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9JM52

KEGG Orthology (KO)

More...
KOi
K04413

Database of Orthologous Groups

More...
OrthoDBi
533537at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001180, CNH_dom
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00780, CNH, 1 hit
PF00069, Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00036, CNH, 1 hit
SM00220, S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50219, CNH, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 21 Publication (identifier: Q9JM52-1) [UniParc]FASTAAdd to basket
Also known as: MiNK-2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDPAPARSL DDIDLSALRD PAGIFELVEV VGNGTYGQVY KGRHVKTGQL
60 70 80 90 100
AAIKVMDVTE DEEEEIKQEI NMLKKYSHHR NIATYYGAFI KKSPPGNDDQ
110 120 130 140 150
LWLVMEFCGA GSVTDLVKNT KGNALKEDCI AYICREILRG LAHLHAHKVI
160 170 180 190 200
HRDIKGQNVL LTENAEVKLV DFGVSAQLDR TVGRRNTFIG TPYWMAPEVI
210 220 230 240 250
ACDENPDATY DYRSDIWSLG ITAIEMAEGA PPLCDMHPMR ALFLIPRNPP
260 270 280 290 300
PRLKSKKWSK KFTDFIDTCL IKTYLSRPPT EQLLKFPFIR DQPTERQVRI
310 320 330 340 350
QLKDHIDRSR KKRGEKEETE YEYSGSEEED DSHGEEGEPS SIMNVPGEST
360 370 380 390 400
LRREFLRLQQ ENKSNSEALK QQQQLQQQQQ RDPEAHIKHL LHQRQRRIEE
410 420 430 440 450
QKEERRRVEE QQRREREQRK LQEKEQQRRL EDMQALRREE ERRQAEREQE
460 470 480 490 500
YKRKQLEEQR QSERLQRQLQ QEHAYLKSLQ QQQQQQQLQK QQQQQQQILP
510 520 530 540 550
GDRKPLYHYG RGINPADKPA WAREVEERAR MNKQQNSPLA KAKPSSAGPE
560 570 580 590 600
PPISQASPSP PGPLSQTPPM QRPVEPQEGP HKSLVAHRVP LKPYAAPVPR
610 620 630 640 650
SQSLQDQPTR NLAAFPASHD PDPAAVPTPT ATPSARGAVI RQNSDPTSEG
660 670 680 690 700
PGPSPNPPSW VRPDNEAPPK VPQRTSSIAT ALNTSGAGGS RPAQAVRASN
710 720 730 740 750
PDLRRSDPGW ERSDSVLPAS HGHLPQAGSL ERNRNRVGAS TKLDSSPVLS
760 770 780 790 800
PGNKAKPEDH RSRPGRPASY KRAIGEDFVL LKERTLDEAP KPPKKAMDYS
810 820 830 840 850
SSSEEVESSE EEEEEGDGEP SEGSRDTPGG RSDGDTDSVS TMVVHDVEEI
860 870 880 890 900
SGTQPSYGGG TMVVQRTPEE ERSLLLADSN GYTNLPDVVQ PSHSPTENSK
910 920 930 940 950
GQSPPTKDGG SDYQSRGLVK APGKSSFTMF VDLGIYQPGG SGDTIPITAL
960 970 980 990 1000
VGGEGGRLDQ LQFDVRKGSV VNVNPTNTRA HSETPEIRKY KKRFNSEILC
1010 1020 1030 1040 1050
AALWGVNLLV GTENGLMLLD RSGQGKVYGL IGRRRFQQMD VLEGLNLLIT
1060 1070 1080 1090 1100
ISGKRNKLRV YYLSWLRNKI LHNDPEVEKK QGWTTVGDME GCGHYRVVKY
1110 1120 1130 1140 1150
ERIKFLVIAL KNSVEVYAWA PKPYHKFMAF KSFADLPHRP LLVDLTVEEG
1160 1170 1180 1190 1200
QRLKVIYGSS AGFHAVDVDS GNSYDIYIPV HIQSQITPHA IIFLPNTDGM
1210 1220 1230 1240 1250
EMLLCYEDEG VYVNTYGRII KDVVLQWGEM PTSVAYICSN QIMGWGEKAI
1260 1270 1280 1290 1300
EIRSVETGHL DGVFMHKRAQ RLKFLCERND KVFFASVRSG GSSQVYFMTL

NRNCIMNW
Length:1,308
Mass (Da):147,295
Last modified:July 27, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i455E546EC5459B47
GO
Isoform 11 Publication (identifier: Q9JM52-2) [UniParc]FASTAAdd to basket
Also known as: MiNK-1

The sequence of this isoform differs from the canonical sequence as follows:
     769-776: Missing.

Show »
Length:1,300
Mass (Da):146,390
Checksum:i9DB699C6D1F39C54
GO
Isoform 31 Publication (identifier: Q9JM52-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     698-698: A → ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNAS

Show »
Length:1,345
Mass (Da):151,310
Checksum:i0A23B48F645B9258
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3X9G2G3X9G2_MOUSE
Misshapen-like kinase 1
Mink1
1,344Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5SXG3Q5SXG3_MOUSE
Misshapen-like kinase 1
Mink1
1,337Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5SXG1Q5SXG1_MOUSE
Misshapen-like kinase 1
Mink1
1,334Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7AMS7F7AMS7_MOUSE
Misshapen-like kinase 1
Mink1
1,198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QP32J3QP32_MOUSE
Misshapen-like kinase 1
Mink1
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QM71J3QM71_MOUSE
Misshapen-like kinase 1
Mink1
259Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti221I → V in AAH11346 (PubMed:15489334).Curated1
Sequence conflicti243F → L in AAH11346 (PubMed:15489334).Curated1
Sequence conflicti317E → R in AAH11346 (PubMed:15489334).Curated1
Sequence conflicti542 – 546AKPSS → RSQAG in BAA90752 (PubMed:10708748).Curated5
Sequence conflicti542 – 546AKPSS → RSQAG in BAA94837 (PubMed:10708748).Curated5
Sequence conflicti832Missing in AAH11346 (PubMed:15489334).Curated1
Sequence conflicti840S → T in BAA94837 (PubMed:10708748).Curated1
Sequence conflicti840S → T in BAA90752 (PubMed:10708748).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_007061698A → ARPRSNSAWQIYLQRRAERG TPKPPGPPAQPPGPPNAS in isoform 3. 1 Publication1
Alternative sequenceiVSP_007062769 – 776Missing in isoform 1. 1 Publication8

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB041925 mRNA Translation: BAA94837.1
AB035697 mRNA Translation: BAA90752.1
AL592547 Genomic DNA No translation available.
CR933736 Genomic DNA No translation available.
CH466596 Genomic DNA Translation: EDL12579.1
BC011346 mRNA Translation: AAH11346.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS24954.1 [Q9JM52-2]
CCDS24955.1 [Q9JM52-1]

NCBI Reference Sequences

More...
RefSeqi
NP_057922.2, NM_016713.2 [Q9JM52-2]
NP_795712.2, NM_176893.2 [Q9JM52-1]
XP_006533744.1, XM_006533681.3 [Q9JM52-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000102558; ENSMUSP00000099618; ENSMUSG00000020827 [Q9JM52-2]
ENSMUST00000102559; ENSMUSP00000099619; ENSMUSG00000020827 [Q9JM52-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
50932

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:50932

UCSC genome browser

More...
UCSCi
uc007jvj.1, mouse [Q9JM52-1]
uc007jvl.1, mouse [Q9JM52-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB041925 mRNA Translation: BAA94837.1
AB035697 mRNA Translation: BAA90752.1
AL592547 Genomic DNA No translation available.
CR933736 Genomic DNA No translation available.
CH466596 Genomic DNA Translation: EDL12579.1
BC011346 mRNA Translation: AAH11346.1
CCDSiCCDS24954.1 [Q9JM52-2]
CCDS24955.1 [Q9JM52-1]
RefSeqiNP_057922.2, NM_016713.2 [Q9JM52-2]
NP_795712.2, NM_176893.2 [Q9JM52-1]
XP_006533744.1, XM_006533681.3 [Q9JM52-3]

3D structure databases

SMRiQ9JM52
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi206164, 11 interactors
CORUMiQ9JM52
IntActiQ9JM52, 8 interactors
MINTiQ9JM52
STRINGi10090.ENSMUSP00000072649

PTM databases

iPTMnetiQ9JM52
PhosphoSitePlusiQ9JM52

Proteomic databases

jPOSTiQ9JM52
PaxDbiQ9JM52
PeptideAtlasiQ9JM52
PRIDEiQ9JM52

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
5678, 219 antibodies

Genome annotation databases

EnsembliENSMUST00000102558; ENSMUSP00000099618; ENSMUSG00000020827 [Q9JM52-2]
ENSMUST00000102559; ENSMUSP00000099619; ENSMUSG00000020827 [Q9JM52-1]
GeneIDi50932
KEGGimmu:50932
UCSCiuc007jvj.1, mouse [Q9JM52-1]
uc007jvl.1, mouse [Q9JM52-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
50488
MGIiMGI:1355329, Mink1

Phylogenomic databases

eggNOGiKOG0587, Eukaryota
GeneTreeiENSGT00950000183196
HOGENOMiCLU_001831_2_0_1
InParanoidiQ9JM52
KOiK04413
OrthoDBi533537at2759

Enzyme and pathway databases

ReactomeiR-MMU-2559580, Oxidative Stress Induced Senescence

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
50932, 1 hit in 20 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Mink1, mouse

Protein Ontology

More...
PROi
PR:Q9JM52
RNActiQ9JM52, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000020827, Expressed in visual cortex and 273 other tissues
ExpressionAtlasiQ9JM52, baseline and differential
GenevisibleiQ9JM52, MM

Family and domain databases

InterProiView protein in InterPro
IPR001180, CNH_dom
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00780, CNH, 1 hit
PF00069, Pkinase, 1 hit
SMARTiView protein in SMART
SM00036, CNH, 1 hit
SM00220, S_TKc, 1 hit
SUPFAMiSSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50219, CNH, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMINK1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JM52
Secondary accession number(s): Q5SXG2, Q921M6, Q9JM92
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 28, 2003
Last sequence update: July 27, 2011
Last modified: August 12, 2020
This is version 179 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again