Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Single Ig IL-1-related receptor

Gene

Sigirr

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity).By similarity1 Publication

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Single Ig IL-1-related receptor
Alternative name(s):
Single Ig IL-1R-related molecule
Single immunoglobulin domain-containing IL1R-related protein
Toll/interleukin-1 receptor 8
Short name:
TIR8
Gene namesi
Name:Sigirr
Synonyms:Tir8
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1344402 Sigirr

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 117ExtracellularSequence analysisAdd BLAST117
Transmembranei118 – 138Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini139 – 409CytoplasmicSequence analysisAdd BLAST271

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000990661 – 409Single Ig IL-1-related receptorAdd BLAST409

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi31N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi32 ↔ 97PROSITE-ProRule annotation
Glycosylationi58N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi73N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi85N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi101N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei382PhosphoserineCombined sources1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9JLZ8
PaxDbiQ9JLZ8
PRIDEiQ9JLZ8

PTM databases

iPTMnetiQ9JLZ8
PhosphoSitePlusiQ9JLZ8

Expressioni

Tissue specificityi

Expressed at high levels in kidney, and at moderate levels in colon, small intestine, lung, spleen and liver. Not expressed in brain and muscle. Expressed at high levels in epithelial cells, at moderate levels in splenocytes, and at low or undetectable levels in fibroblasts or endothelial cells. Expressed in mucosal and dendritic cells.3 Publications

Inductioni

Down-regulated by LPS. Down-regulated during inflammation by inhibition of an SP1-mediated pathway.2 Publications

Gene expression databases

BgeeiENSMUSG00000025494 Expressed in 164 organ(s), highest expression level in adult mammalian kidney
ExpressionAtlasiQ9JLZ8 baseline and differential
GenevisibleiQ9JLZ8 MM

Interactioni

Subunit structurei

Interacts with IL1R1, IRAK1, TLR4, TLR5, TLR9 and TRAF6. Upon IL-1 stimulation found in a complex at least composed of IL1R1, SIGIRR, MYD88, IRAK1 and TRAF6. Upon stimulation with LPC found in a complex at least composed of TLR4, SIG1IR, MYD88, IRAK1 and TRAF6. Interacts with PALM3 (By similarity).By similarity

Protein-protein interaction databases

IntActiQ9JLZ8, 1 interactor
MINTiQ9JLZ8
STRINGi10090.ENSMUSP00000095571

Structurei

3D structure databases

ProteinModelPortaliQ9JLZ8
SMRiQ9JLZ8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini9 – 108Ig-like C2-typeAdd BLAST100
Domaini162 – 309TIRPROSITE-ProRule annotationAdd BLAST148

Sequence similaritiesi

Belongs to the interleukin-1 receptor family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEXB Eukaryota
ENOG410ZFDI LUCA
GeneTreeiENSGT00760000119071
HOGENOMiHOG000237348
HOVERGENiHBG080781
InParanoidiQ9JLZ8
KOiK05169
OMAiYLEQDWC
OrthoDBiEOG091G0GXW
PhylomeDBiQ9JLZ8
TreeFamiTF325519

Family and domain databases

Gene3Di2.60.40.10, 1 hit
3.40.50.10140, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR015621 IL-1_rcpt_fam
IPR000157 TIR_dom
IPR035897 Toll_tir_struct_dom_sf
PANTHERiPTHR11890 PTHR11890, 1 hit
PfamiView protein in Pfam
PF13895 Ig_2, 1 hit
PF01582 TIR, 1 hit
SMARTiView protein in SMART
SM00255 TIR, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
SSF52200 SSF52200, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
PS50104 TIR, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9JLZ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGVCDMAPN FLSPSEDQAL GLALGREVAL NCTAWVFSRP QCPQPSVQWL
60 70 80 90 100
KDGLALGNGS HFSLHEDFWV SANFSEIVSS VLVLNLTNAE DYGTFTCSVW
110 120 130 140 150
NVSSHSFTLW RAGPAGHVAA VLASLLVLVV LLLVALLYVK CRLNMLLWYQ
160 170 180 190 200
DTYGEVEMND GKLYDAYVSY SDCPEDRKFV NFILKPQLER RRGYKLFLED
210 220 230 240 250
RDLLPRAEPS ADLLVNLSRC RRLIVVLSDA FLSRPWCSQS FREGLCRLLE
260 270 280 290 300
LTRRPIFITF EGQRREPIHP ALRLLRQHRH LVTLVLWKPG SVTPSSDFWK
310 320 330 340 350
ELQLALPRKV QYRPVEGDPQ TRLQDDKDPM LIVRGRAAQG RGMESELDPD
360 370 380 390 400
PEGDLGVRGP VFGEPPTPLQ ETRICIGESH GSEMDVSDLG SRNYSARTDF

YCLVSEDDV
Length:409
Mass (Da):46,159
Last modified:September 27, 2005 - v2
Checksum:i9D175DC27AAFBE18
GO
Isoform 2 (identifier: Q9JLZ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     357-409: VRGPVFGEPP...FYCLVSEDDV → MLTADQGVKHSSSVLERTQAWRTLASRDPVS

Note: No experimental confirmation available.
Show »
Length:387
Mass (Da):43,753
Checksum:i2D00E899D2707076
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GRZ7A0A1B0GRZ7_MOUSE
Single Ig IL-1-related receptor
Sigirr
108Annotation score:
A0A1B0GRA6A0A1B0GRA6_MOUSE
Single Ig IL-1-related receptor
Sigirr
85Annotation score:
A0A1B0GS99A0A1B0GS99_MOUSE
Single Ig IL-1-related receptor
Sigirr
20Annotation score:

Sequence cautioni

The sequence AAF26200 differs from that shown. Reason: Frameshift at positions 244 and 275.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti154G → R in AAF26200 (PubMed:14993616).Curated1
Sequence conflicti208 – 209EP → DA in AAF26200 (PubMed:14993616).Curated2
Sequence conflicti277 – 278QH → HD in AAF26200 (PubMed:14993616).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015718357 – 409VRGPV…SEDDV → MLTADQGVKHSSSVLERTQA WRTLASRDPVS in isoform 2. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF113795 mRNA Translation: AAF26200.1 Frameshift.
BC010806 mRNA Translation: AAH10806.1
BC094069 mRNA Translation: AAH94069.1
CCDSiCCDS40179.1 [Q9JLZ8-1]
RefSeqiNP_075546.2, NM_023059.3 [Q9JLZ8-1]
XP_006536239.1, XM_006536176.2
XP_006536240.1, XM_006536177.3 [Q9JLZ8-1]
XP_006536241.1, XM_006536178.3 [Q9JLZ8-1]
XP_006536242.1, XM_006536179.3 [Q9JLZ8-1]
XP_006536243.1, XM_006536180.2 [Q9JLZ8-1]
UniGeneiMm.38017

Genome annotation databases

EnsembliENSMUST00000097958; ENSMUSP00000095571; ENSMUSG00000025494 [Q9JLZ8-1]
ENSMUST00000209294; ENSMUSP00000147541; ENSMUSG00000025494 [Q9JLZ8-1]
ENSMUST00000210167; ENSMUSP00000147280; ENSMUSG00000025494 [Q9JLZ8-2]
GeneIDi24058
KEGGimmu:24058
UCSCiuc009kjk.1 mouse [Q9JLZ8-1]
uc009kjm.1 mouse [Q9JLZ8-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF113795 mRNA Translation: AAF26200.1 Frameshift.
BC010806 mRNA Translation: AAH10806.1
BC094069 mRNA Translation: AAH94069.1
CCDSiCCDS40179.1 [Q9JLZ8-1]
RefSeqiNP_075546.2, NM_023059.3 [Q9JLZ8-1]
XP_006536239.1, XM_006536176.2
XP_006536240.1, XM_006536177.3 [Q9JLZ8-1]
XP_006536241.1, XM_006536178.3 [Q9JLZ8-1]
XP_006536242.1, XM_006536179.3 [Q9JLZ8-1]
XP_006536243.1, XM_006536180.2 [Q9JLZ8-1]
UniGeneiMm.38017

3D structure databases

ProteinModelPortaliQ9JLZ8
SMRiQ9JLZ8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9JLZ8, 1 interactor
MINTiQ9JLZ8
STRINGi10090.ENSMUSP00000095571

PTM databases

iPTMnetiQ9JLZ8
PhosphoSitePlusiQ9JLZ8

Proteomic databases

EPDiQ9JLZ8
PaxDbiQ9JLZ8
PRIDEiQ9JLZ8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000097958; ENSMUSP00000095571; ENSMUSG00000025494 [Q9JLZ8-1]
ENSMUST00000209294; ENSMUSP00000147541; ENSMUSG00000025494 [Q9JLZ8-1]
ENSMUST00000210167; ENSMUSP00000147280; ENSMUSG00000025494 [Q9JLZ8-2]
GeneIDi24058
KEGGimmu:24058
UCSCiuc009kjk.1 mouse [Q9JLZ8-1]
uc009kjm.1 mouse [Q9JLZ8-2]

Organism-specific databases

CTDi59307
MGIiMGI:1344402 Sigirr

Phylogenomic databases

eggNOGiENOG410IEXB Eukaryota
ENOG410ZFDI LUCA
GeneTreeiENSGT00760000119071
HOGENOMiHOG000237348
HOVERGENiHBG080781
InParanoidiQ9JLZ8
KOiK05169
OMAiYLEQDWC
OrthoDBiEOG091G0GXW
PhylomeDBiQ9JLZ8
TreeFamiTF325519

Miscellaneous databases

PROiPR:Q9JLZ8
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000025494 Expressed in 164 organ(s), highest expression level in adult mammalian kidney
ExpressionAtlasiQ9JLZ8 baseline and differential
GenevisibleiQ9JLZ8 MM

Family and domain databases

Gene3Di2.60.40.10, 1 hit
3.40.50.10140, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR015621 IL-1_rcpt_fam
IPR000157 TIR_dom
IPR035897 Toll_tir_struct_dom_sf
PANTHERiPTHR11890 PTHR11890, 1 hit
PfamiView protein in Pfam
PF13895 Ig_2, 1 hit
PF01582 TIR, 1 hit
SMARTiView protein in SMART
SM00255 TIR, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
SSF52200 SSF52200, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit
PS50104 TIR, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSIGIR_MOUSE
AccessioniPrimary (citable) accession number: Q9JLZ8
Secondary accession number(s): Q52L48
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: September 27, 2005
Last modified: November 7, 2018
This is version 142 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again