Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (08 May 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Calpain-15

Gene

Capn15

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei562By similarity1
Active sitei727By similarity1
Active sitei747By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri3 – 32RanBP2-type 1PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri44 – 73RanBP2-type 2PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri148 – 178RanBP2-type 3PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri348 – 379RanBP2-type 4PROSITE-ProRule annotationAdd BLAST32
Zinc fingeri422 – 451RanBP2-type 5PROSITE-ProRule annotationAdd BLAST30

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium-dependent cysteine-type endopeptidase activity Source: GO_Central
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1474228 Degradation of the extracellular matrix

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calpain-15 (EC:3.4.22.-)
Alternative name(s):
Small optic lobes homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Capn15
Synonyms:Solh
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1355075 Capn15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002787711 – 1095Calpain-15Add BLAST1095

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei311PhosphoserineBy similarity1
Modified residuei345PhosphoserineBy similarity1
Modified residuei348PhosphoserineBy similarity1
Modified residuei1079PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9JLG8

PRoteomics IDEntifications database

More...
PRIDEi
Q9JLG8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9JLG8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9JLG8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in olfactory bulbs (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000037326 Expressed in 252 organ(s), highest expression level in ear vesicle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9JLG8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9JLG8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
206132, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000039528

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini497 – 803Calpain catalyticPROSITE-ProRule annotationAdd BLAST307

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi124 – 148Glu-richAdd BLAST25

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C2 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri3 – 32RanBP2-type 1PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri44 – 73RanBP2-type 2PROSITE-ProRule annotationAdd BLAST30
Zinc fingeri148 – 178RanBP2-type 3PROSITE-ProRule annotationAdd BLAST31
Zinc fingeri348 – 379RanBP2-type 4PROSITE-ProRule annotationAdd BLAST32
Zinc fingeri422 – 451RanBP2-type 5PROSITE-ProRule annotationAdd BLAST30

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0045 Eukaryota
ENOG410XP0B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158312

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007650

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9JLG8

KEGG Orthology (KO)

More...
KOi
K08582

Identification of Orthologs from Complete Genome Data

More...
OMAi
CTRCTFL

Database of Orthologous Groups

More...
OrthoDBi
704215at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9JLG8

TreeFam database of animal gene trees

More...
TreeFami
TF322245

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00044 CysPc, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022684 Calpain_cysteine_protease
IPR038765 Papain-like_cys_pep_sf
IPR000169 Pept_cys_AS
IPR001300 Peptidase_C2_calpain_cat
IPR001876 Znf_RanBP2
IPR036443 Znf_RanBP2_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00648 Peptidase_C2, 1 hit
PF00641 zf-RanBP, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00704 CALPAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00230 CysPc, 1 hit
SM00547 ZnF_RBZ, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54001 SSF54001, 1 hit
SSF90209 SSF90209, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50203 CALPAIN_CAT, 1 hit
PS00139 THIOL_PROTEASE_CYS, 1 hit
PS01358 ZF_RANBP2_1, 5 hits
PS50199 ZF_RANBP2_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9JLG8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATVGEWSCA RCTFLNPAGQ RQCSICEAPR HKPDLDQILR LSVEEQKWPC
60 70 80 90 100
ARCTFRNFLG KEACEVCGFT PEPVPGAPLL PIINGVLPKP PTILVEPKGS
110 120 130 140 150
GKEEAGPVRT AGLVATEPAR GRPEGEEERE ERGEEEEKEQ EGEGERAEPG
160 170 180 190 200
SGWACQRCTL HNTPVASSCS ACGGPRKLSL PRIPPEALVV PEVVAPTGFH
210 220 230 240 250
VVPAPSQPVL PGEGAEADSP STSQGPTSTD QEPPRVPLFS PFSPTLQNNP
260 270 280 290 300
VPRSRREVPP QLQPPVPEAV QSSASTSSKG PQQGPGRAAA GASRLAELLS
310 320 330 340 350
GKELLPGKRL SVLEEEVPES SPARCESCSD VIDLAGDIVR YTPASPSSPD
360 370 380 390 400
FTTWSCARCT LRNPTTAPRC SVCGGSKLHG FQEHSEPPTH CPDCGANKPG
410 420 430 440 450
PCVGSCGRAP SAHKAVRLLP DRPGQWACPA CTLINTPRAK HCAACHTPQL
460 470 480 490 500
LVTQCRGATP LRRRESMHVE KRRQTDEGEA KALWENIVAF CRENSVNFVD
510 520 530 540 550
DSFPPGPASV GFPVGDSVQQ RVKQWLRPHE INCSVFRDHG TPWSVFHTLR
560 570 580 590 600
PSDILQGLLG NCWFLSALAV LAERPDLVER VMVTRSLCAE GAYQVRLCKD
610 620 630 640 650
GTWTTVLVDD MLPCDEAGFL LFSQAQRKQL WVALIEKALA KLHGSYFALQ
660 670 680 690 700
AGRAIEGLAT LTGAPCESLA LQVSSTNPRE EPVDTDLIWA KMLSSKEAGF
710 720 730 740 750
LMGASCGGGN MKVDDAAYES LGLRPRHAYS VLDVRDVQGS RLLRLRNPWG
760 770 780 790 800
RFSWNGSWSD EWPHWPGHLR AELMPHGSSE GVFWMEYSDF IRYFDSVDIC
810 820 830 840 850
KVHSDWQEAR VQGCFPSTAG GPVGVTALTV LERASLEFAL FQEGSRRSDS
860 870 880 890 900
VDSHLLDLCI LVFRATFGTG GRLSLGRLLA HSKRAVKKFV NCDVMLEPGE
910 920 930 940 950
YAVVCCAFNH WNPAPPGPPA QASSPSAGVP RGAPEPPGHV LAVYSSRLVM
960 970 980 990 1000
VEPVEAQPTT LADAIILLTE SRGERHEGRE GMTCYYLTHG WAGLIVVVEN
1010 1020 1030 1040 1050
RHPKSYLHVQ CDCTDSFNVV STRGSLRTQD SVPPLHRQVL VILSQLEGNA
1060 1070 1080 1090
GFSITHRLAH RKAAQAFLSD WTASRGTHSP PLTPDVAGLH GPRPL
Length:1,095
Mass (Da):118,719
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i081E1DFED2AE5D28
GO
Isoform 2 (identifier: Q9JLG8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-921: Q → QGKGPSQMRPTPSFPTSEPQSPPTGKLLAPLSTPPT
     978-1037: GREGMTCYYL...TQDSVPPLHR → VGGVLMGEGR...APQVLPACAM
     1038-1095: Missing.

Note: No experimental confirmation available.
Show »
Length:1,072
Mass (Da):115,346
Checksum:i77A7CC84EA7B7DD0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1D5RLS3A0A1D5RLS3_MOUSE
Calpain-15
Capn15
1,196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RLJ4A0A1D5RLJ4_MOUSE
Calpain-15
Capn15
955Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RLI7A0A1D5RLI7_MOUSE
Calpain-15
Capn15
502Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_023363921Q → QGKGPSQMRPTPSFPTSEPQ SPPTGKLLAPLSTPPT in isoform 2. 1 Publication1
Alternative sequenceiVSP_023364978 – 1037GREGM…PPLHR → VGGVLMGEGRGWATTSPGPP TLCLCPGSRGHDLLLPDSWL GGTHRGSGEPAPQVLPACAM in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_0233651038 – 1095Missing in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF180445 Genomic DNA Translation: AAF62871.1
BC058094 mRNA Translation: AAH58094.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28540.1 [Q9JLG8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_056645.1, NM_015830.1 [Q9JLG8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326 [Q9JLG8-1]
ENSMUST00000212149; ENSMUSP00000148718; ENSMUSG00000037326 [Q9JLG8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
50817

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:50817

UCSC genome browser

More...
UCSCi
uc008bcz.1 mouse [Q9JLG8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF180445 Genomic DNA Translation: AAF62871.1
BC058094 mRNA Translation: AAH58094.1
CCDSiCCDS28540.1 [Q9JLG8-1]
RefSeqiNP_056645.1, NM_015830.1 [Q9JLG8-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi206132, 2 interactors
STRINGi10090.ENSMUSP00000039528

PTM databases

iPTMnetiQ9JLG8
PhosphoSitePlusiQ9JLG8

Proteomic databases

PaxDbiQ9JLG8
PRIDEiQ9JLG8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000041641; ENSMUSP00000039528; ENSMUSG00000037326 [Q9JLG8-1]
ENSMUST00000212149; ENSMUSP00000148718; ENSMUSG00000037326 [Q9JLG8-1]
GeneIDi50817
KEGGimmu:50817
UCSCiuc008bcz.1 mouse [Q9JLG8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6650
MGIiMGI:1355075 Capn15

Phylogenomic databases

eggNOGiKOG0045 Eukaryota
ENOG410XP0B LUCA
GeneTreeiENSGT00940000158312
HOGENOMiHOG000007650
InParanoidiQ9JLG8
KOiK08582
OMAiCTRCTFL
OrthoDBi704215at2759
PhylomeDBiQ9JLG8
TreeFamiTF322245

Enzyme and pathway databases

ReactomeiR-MMU-1474228 Degradation of the extracellular matrix

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Capn15 mouse

Protein Ontology

More...
PROi
PR:Q9JLG8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000037326 Expressed in 252 organ(s), highest expression level in ear vesicle
ExpressionAtlasiQ9JLG8 baseline and differential
GenevisibleiQ9JLG8 MM

Family and domain databases

CDDicd00044 CysPc, 1 hit
InterProiView protein in InterPro
IPR022684 Calpain_cysteine_protease
IPR038765 Papain-like_cys_pep_sf
IPR000169 Pept_cys_AS
IPR001300 Peptidase_C2_calpain_cat
IPR001876 Znf_RanBP2
IPR036443 Znf_RanBP2_sf
PfamiView protein in Pfam
PF00648 Peptidase_C2, 1 hit
PF00641 zf-RanBP, 4 hits
PRINTSiPR00704 CALPAIN
SMARTiView protein in SMART
SM00230 CysPc, 1 hit
SM00547 ZnF_RBZ, 5 hits
SUPFAMiSSF54001 SSF54001, 1 hit
SSF90209 SSF90209, 4 hits
PROSITEiView protein in PROSITE
PS50203 CALPAIN_CAT, 1 hit
PS00139 THIOL_PROTEASE_CYS, 1 hit
PS01358 ZF_RANBP2_1, 5 hits
PS50199 ZF_RANBP2_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAN15_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JLG8
Secondary accession number(s): Q6PEE9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: October 1, 2000
Last modified: May 8, 2019
This is version 127 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again