Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thyrotroph embryonic factor

Gene

Tef

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Transcription factor that binds to and transactivates the TSHB promoter. Binds to a minimal DNA-binding sequence 5'-[TC][AG][AG]TTA[TC][AG]-3' (By similarity). Also activates the telokin promoter in smooth muscle-specific and calcium-dependent manner.By similarity

Miscellaneous

Mice deficient for all three PAR bZIP proteins (DBP, HLF and TEF) display a dramatically shortened life span and are highly susceptible to generalized spontaneous and audiogenic epilepsies (due for example to the noise of a vacuum cleaner) that are frequently lethal. The down-regulation of pyridoxal kinase (Pdxk) expression in these mice may participate in this seizure phenotype.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processBiological rhythms, Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Thyrotroph embryonic factor
Gene namesi
Name:Tef
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:98663 Tef

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000765131 – 301Thyrotroph embryonic factorAdd BLAST301

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei30PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9JLC6
PRIDEiQ9JLC6

PTM databases

iPTMnetiQ9JLC6
PhosphoSitePlusiQ9JLC6

Expressioni

Tissue specificityi

Isoform Alpha and isoform Beta are expressed at high levels in lung, bladder, kidney, gut and brain.

Inductioni

Accumulates according to a robust circadian rhythm in liver and kidney. In liver nuclei, the amplitude of daily oscillation has been estimated to be 9-fold. Expressed at nearly constant level in the brain.

Gene expression databases

BgeeiENSMUSG00000022389
CleanExiMM_TEF
ExpressionAtlasiQ9JLC6 baseline and differential
GenevisibleiQ9JLC6 MM

Interactioni

Subunit structurei

Binds DNA as a homodimer or a heterodimer. Can form a heterodimer with DBP (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204106, 3 interactors
STRINGi10090.ENSMUSP00000023024

Structurei

3D structure databases

ProteinModelPortaliQ9JLC6
SMRiQ9JLC6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini231 – 294bZIPPROSITE-ProRule annotationAdd BLAST64

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni233 – 253Basic motifPROSITE-ProRule annotationAdd BLAST21
Regioni254 – 261Leucine-zipperPROSITE-ProRule annotation8

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi164 – 215Pro-rich (proline/acidic region (PAR))Add BLAST52

Sequence similaritiesi

Belongs to the bZIP family. PAR subfamily.Curated

Phylogenomic databases

eggNOGiKOG3119 Eukaryota
ENOG410YJ8G LUCA
GeneTreeiENSGT00440000039070
HOVERGENiHBG004983
InParanoidiQ9JLC6
KOiK09058
OMAiSKYETRY
OrthoDBiEOG091G0EO0
PhylomeDBiQ9JLC6
TreeFamiTF315869

Family and domain databases

InterProiView protein in InterPro
IPR004827 bZIP
IPR029832 TEF/VBP
PANTHERiPTHR11988:SF24 PTHR11988:SF24, 1 hit
PfamiView protein in Pfam
PF07716 bZIP_2, 1 hit
SMARTiView protein in SMART
SM00338 BRLZ, 1 hit
PROSITEiView protein in PROSITE
PS50217 BZIP, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative promoter usage. AlignAdd to basket

Isoform Alpha (identifier: Q9JLC6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDAGGGKKP PVEPQAGPGP GRAAGERGLS GSFPLVLKKL MENPPRETRL
60 70 80 90 100
DKEKGKEKLE EDESAAASTM AVSASLMPPI WDKTIPYDGE SFHLEYMDLD
110 120 130 140 150
EFLLENGIPA SPTHLAQNLL LPVAELEGKE SASSSTASPP SSSTAIFQPS
160 170 180 190 200
ETVSSTESSL EKERETPSPI DPSCVEVDVN FNPDPADLVL SSVPGGELFN
210 220 230 240 250
PRKHRFAEED LKPQPMIKKA KKVFVPDEQK DEKYWTRRKK NNVAAKRSRD
260 270 280 290 300
ARRLKENQIT IRAAFLEKEN TALRTEVAEL RKEVGKCKTI VSKYETKYGP

L
Length:301
Mass (Da):33,145
Last modified:October 1, 2000 - v1
Checksum:iF83FFFC6D7E091A4
GO
Isoform Beta (identifier: Q9JLC6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSDAGGGKKP...MENPPRETRL → MSSCSQIGVAPAMDMPEVLKSLLEHSLPWSEKKA

Show »
Length:285
Mass (Da):31,707
Checksum:i9478FD36092F41EA
GO
Isoform 2 (identifier: Q9JLC6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSDAGGGKKPPVEPQAGPGPGRAAGERGLSGSFPLVLKKLMENPPRETRL → MDMPEVLKSLLEHSLPWSEKKA

Show »
Length:273
Mass (Da):30,575
Checksum:i49626F12DE8BAE6E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti38K → R in BAE26249 (PubMed:16141072).Curated1
Sequence conflicti97M → V in BAC35849 (PubMed:16141072).Curated1
Sequence conflicti191S → C in BAE28255 (PubMed:16141072).Curated1
Sequence conflicti219K → E in BAE26249 (PubMed:16141072).Curated1
Sequence conflicti224F → L in BAE26249 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0112461 – 50MSDAG…RETRL → MDMPEVLKSLLEHSLPWSEK KA in isoform 2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0112451 – 50MSDAG…RETRL → MSSCSQIGVAPAMDMPEVLK SLLEHSLPWSEKKA in isoform Beta. 2 PublicationsAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF194420 mRNA Translation: AAF70830.1
AY540631 mRNA Translation: AAS45599.1
AY540632 mRNA Translation: AAS45600.1
AK075601 mRNA Translation: BAC35849.1
AK141606 mRNA Translation: BAE24760.1
AK145125 mRNA Translation: BAE26249.1
AK147965 mRNA Translation: BAE28255.1
AK154472 mRNA Translation: BAE32609.1
BC017689 mRNA Translation: AAH17689.1
BC036982 mRNA Translation: AAH36982.1
CCDSiCCDS27671.2 [Q9JLC6-2]
CCDS27672.1 [Q9JLC6-1]
RefSeqiNP_059072.1, NM_017376.3 [Q9JLC6-1]
NP_705617.2, NM_153484.3 [Q9JLC6-2]
UniGeneiMm.270278

Genome annotation databases

EnsembliENSMUST00000023024; ENSMUSP00000023024; ENSMUSG00000022389 [Q9JLC6-1]
ENSMUST00000109553; ENSMUSP00000105180; ENSMUSG00000022389 [Q9JLC6-2]
GeneIDi21685
KEGGimmu:21685
UCSCiuc007wxj.2 mouse [Q9JLC6-2]
uc007wxk.2 mouse [Q9JLC6-1]

Keywords - Coding sequence diversityi

Alternative promoter usage

Similar proteinsi

Entry informationi

Entry nameiTEF_MOUSE
AccessioniPrimary (citable) accession number: Q9JLC6
Secondary accession number(s): Q3U426
, Q3UGF4, Q3UM49, Q3URC8, Q6QHT6, Q8C6I0, Q8VD02
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: October 1, 2000
Last modified: June 20, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health