Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (05 Jun 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Formin-like protein 1

Gene

Fmnl1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape. May play a role in the control of cell motility and survival of macrophages.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5663220 RHO GTPases Activate Formins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Formin-like protein 1
Alternative name(s):
Formin-related protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Fmnl1
Synonyms:Frl, Frl1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1888994 Fmnl1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001948912 – 1094Formin-like protein 1Add BLAST1093

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei7PhosphoserineBy similarity1
Modified residuei184PhosphoserineCombined sources1
Modified residuei688PhosphoserineBy similarity1
Modified residuei1021PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Myristoylation mediates membrane localization.By similarity

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9JL26

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9JL26

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9JL26

PeptideAtlas

More...
PeptideAtlasi
Q9JL26

PRoteomics IDEntifications database

More...
PRIDEi
Q9JL26

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9JL26

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9JL26

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9JL26

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the spleen, lymph node and bone marrow cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000055805 Expressed in 85 organ(s), highest expression level in bone marrow macrophage

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9JL26 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9JL26 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RAC1, PFN1 and PFN2. Interacts (activated by RAC1) with SRGAP2 (via SH3 domain); regulates the actin filament severing activity of FMNL1.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
208325, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q9JL26, 5 interactors

Molecular INTeraction database

More...
MINTi
Q9JL26

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000046296

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9JL26

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini27 – 464GBD/FH3PROSITE-ProRule annotationAdd BLAST438
Domaini627 – 1018FH2PROSITE-ProRule annotationAdd BLAST392
Domaini1049 – 1082DADPROSITE-ProRule annotationAdd BLAST34

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi532 – 611Pro-richAdd BLAST80

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DAD domain regulates activation via by an autoinhibitory interaction with the N-terminus. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the formin homology family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1923 Eukaryota
ENOG410Y3DT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156292

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231209

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9JL26

Identification of Orthologs from Complete Genome Data

More...
OMAi
RINTLTF

Database of Orthologous Groups

More...
OrthoDBi
288325at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9JL26

TreeFam database of animal gene trees

More...
TreeFami
TF325155

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.58.2220, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR014767 DAD_dom
IPR015425 FH2_Formin
IPR042201 FH2_Formin_sf
IPR010472 FH3_dom
IPR027657 FMNL1
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd

The PANTHER Classification System

More...
PANTHERi
PTHR45857:SF2 PTHR45857:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51231 DAD, 1 hit
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9JL26-1) [UniParc]FASTAAdd to basket
Also known as: Frlalpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNAAGSAEQ PAGPTASPPK QPAVPKQPMP AAGELEERFT RVLNCMNLPP
60 70 80 90 100
DKVQLLSQYD NEKKWELICD QERFQVKNPP AAYIQKLKSY LDTGGVSRKV
110 120 130 140 150
ASDWMSNLGF KRRVQESTQV LRELETSLRT NHIGWVQEFL NEENRGLDVL
160 170 180 190 200
LEYLAFAQCS VAYDMESTDS VASGAEKSKP LDQSVEDLSK APPSSVPKSR
210 220 230 240 250
LTIKLTPAHS RKALRNSRIV SQKDDVHVCI MCLRAIMNYQ SGFSLVMNHP
260 270 280 290 300
ACVNEIALSL NNKSPRTKAL VLELLAAVCL VRGGHDIILA AFDNFKEVCG
310 320 330 340 350
EQHRFEKLME YFRHEDSNID FMVACMQFIN IVVHSVENMN FRVFLQYEFT
360 370 380 390 400
HLGLDLYLER LRLTESDKLQ VQIQAYLDNV FDVGTLLEET ETKNAVLEHM
410 420 430 440 450
EELQEQVATL TERLRDTEND SMAKIAELEK QLSQARKELE TLRERFSEST
460 470 480 490 500
PMGTSRRIPE PEKVPVPTVV RPSALELKVE ELEEKGLIRI LRGPGDVVSI
510 520 530 540 550
EILPGAAATP SGDDAQAPRV STDSPSTAES IPEAASPPPP PPPPPPPLPN
560 570 580 590 600
LQSQQEAPPS APPLAPPLPG CAEPPPAPPL PGDLPPPPPP PPLGTDGPVP
610 620 630 640 650
PPPPPPPGGP PDILGGQGPD IGPGVKAKKP IQTKFRMPLL NWVALKPSQI
660 670 680 690 700
TGTVFTELND EKVLQELDMN DFEEHFKTKS QGPCLDISAL KGKASQKAPT
710 720 730 740 750
KTILIEANRA KNLAITLRKG NLGADRICQA IETYDLQTLS LDFLELLTRF
760 770 780 790 800
LPTDYERSLI ARFEKEQRPM EELSEEDRFM LRFSRIQRLP ERMNTLTFLG
810 820 830 840 850
NFPDTAQLLM PQLNAIIAAS MSIKSSDKLR QILEIVLAFG NYMNSSKRGA
860 870 880 890 900
AYGFRLQSLD ALLEMKSTDR KQTLLHYLVK VIAEKYPQLT GFHSDLHFLD
910 920 930 940 950
KAGSVSLDSV LGDVRSLQRG LELTQREFVR QDDCLVLKEF LRANSPTMDK
960 970 980 990 1000
LLADSKTAQE AYESVVEYFG ENPKTTSPSM FFSLFSRFTK AYKKAEQEVE
1010 1020 1030 1040 1050
QWKKEAAADT SGREEPPTPK SPPKARRQQM DLISELKRKQ QKEPLIYESD
1060 1070 1080 1090
RDGAIEDIIT DLRNQPYIRA DTGRRSARRR PPGPPLPVTT DLAL
Length:1,094
Mass (Da):122,060
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i23A4BF24FB8F7A68
GO
Isoform 2 (identifier: Q9JL26-2) [UniParc]FASTAAdd to basket
Also known as: Frlbeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-30: QPMP → MVGT
     1061-1094: DLRNQPYIRADTGRRSARRRPPGPPLPVTTDLAL → VLKTVPFTARTGKRTSRLLCEASLGEEMTL

Show »
Length:1,064
Mass (Da):119,034
Checksum:iCCD961B3B4E329BC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AB60A2AB60_MOUSE
Formin-like 1, isoform CRA_c
Fmnl1 mCG_19154
1,090Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P6X3A0A1W2P6X3_MOUSE
Formin-like protein 1
Fmnl1
1,100Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UWI1G3UWI1_MOUSE
Formin-like protein 1
Fmnl1
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti64K → R in AAD01273 (PubMed:10958683).Curated1
Sequence conflicti94G → D in AAD01273 (PubMed:10958683).Curated1
Sequence conflicti111K → R in AAD01273 (PubMed:10958683).Curated1
Sequence conflicti117S → F in AAD01273 (PubMed:10958683).Curated1
Sequence conflicti581P → H in AAD01273 (PubMed:10958683).Curated1
Sequence conflicti620D → N in AAD01273 (PubMed:10958683).Curated1
Sequence conflicti981F → L in AAD01273 (PubMed:10958683).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0139781 – 26Missing in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_01397927 – 30QPMP → MVGT in isoform 2. 1 Publication4
Alternative sequenceiVSP_0139801061 – 1094DLRNQ…TDLAL → VLKTVPFTARTGKRTSRLLC EASLGEEMTL in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF006466 mRNA Translation: AAD01273.1
AF215666 mRNA Translation: AAF25953.1
AK131173 mRNA Translation: BAD21423.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36348.1 [Q9JL26-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T13963

NCBI Reference Sequences

More...
RefSeqi
NP_001071166.1, NM_001077698.1 [Q9JL26-1]
NP_062653.2, NM_019679.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000042286; ENSMUSP00000046296; ENSMUSG00000055805 [Q9JL26-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57778

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:57778

UCSC genome browser

More...
UCSCi
uc007ltv.1 mouse [Q9JL26-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF006466 mRNA Translation: AAD01273.1
AF215666 mRNA Translation: AAF25953.1
AK131173 mRNA Translation: BAD21423.1
CCDSiCCDS36348.1 [Q9JL26-1]
PIRiT13963
RefSeqiNP_001071166.1, NM_001077698.1 [Q9JL26-1]
NP_062653.2, NM_019679.2

3D structure databases

SMRiQ9JL26
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi208325, 2 interactors
IntActiQ9JL26, 5 interactors
MINTiQ9JL26
STRINGi10090.ENSMUSP00000046296

PTM databases

iPTMnetiQ9JL26
PhosphoSitePlusiQ9JL26
SwissPalmiQ9JL26

Proteomic databases

EPDiQ9JL26
jPOSTiQ9JL26
PaxDbiQ9JL26
PeptideAtlasiQ9JL26
PRIDEiQ9JL26

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57778
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042286; ENSMUSP00000046296; ENSMUSG00000055805 [Q9JL26-1]
GeneIDi57778
KEGGimmu:57778
UCSCiuc007ltv.1 mouse [Q9JL26-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
752
MGIiMGI:1888994 Fmnl1

Phylogenomic databases

eggNOGiKOG1923 Eukaryota
ENOG410Y3DT LUCA
GeneTreeiENSGT00940000156292
HOGENOMiHOG000231209
InParanoidiQ9JL26
OMAiRINTLTF
OrthoDBi288325at2759
PhylomeDBiQ9JL26
TreeFamiTF325155

Enzyme and pathway databases

ReactomeiR-MMU-5663220 RHO GTPases Activate Formins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Fmnl1 mouse

Protein Ontology

More...
PROi
PR:Q9JL26

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000055805 Expressed in 85 organ(s), highest expression level in bone marrow macrophage
ExpressionAtlasiQ9JL26 baseline and differential
GenevisibleiQ9JL26 MM

Family and domain databases

Gene3Di1.20.58.2220, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR014767 DAD_dom
IPR015425 FH2_Formin
IPR042201 FH2_Formin_sf
IPR010472 FH3_dom
IPR027657 FMNL1
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd
PANTHERiPTHR45857:SF2 PTHR45857:SF2, 1 hit
PfamiView protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit
SMARTiView protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51231 DAD, 1 hit
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFMNL1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JL26
Secondary accession number(s): Q6KAN4, Q9Z2V7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: October 1, 2000
Last modified: June 5, 2019
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again