Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9JKS4 (LDB3_MOUSE)

Entry version 160 (02 Jun 2021)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Add a publicationFeedback
Protein

LIM domain-binding protein 3

Gene

Ldb3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM domain-binding protein 3
Alternative name(s):
Protein cypher
Protein oracle
Z-band alternatively spliced PDZ-motif protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ldb3Imported
Synonyms:Kiaa0613
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1344412, Ldb3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000757681 – 723LIM domain-binding protein 3Add BLAST723

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei44PhosphoserineCombined sources1
Modified residuei98PhosphoserineCombined sources1
Modified residuei119PhosphothreonineCombined sources1
Modified residuei121PhosphoserineCombined sources1
Modified residuei123PhosphoserineCombined sources1
Modified residuei214PhosphoserineCombined sources1
Modified residuei216Omega-N-methylarginineCombined sources1
Modified residuei220PhosphoserineCombined sources1
Modified residuei251PhosphoserineCombined sources1
Modified residuei512Omega-N-methylarginineCombined sources1
Modified residuei529Omega-N-methylarginineCombined sources1
Isoform 21 Publication (identifier: Q9JKS4-2)
Modified residuei112PhosphoserineCombined sources1
Isoform 41 Publication (identifier: Q9JKS4-4)
Modified residuei112PhosphoserineCombined sources1
Modified residuei291Omega-N-methylarginineCombined sources1
Isoform 62 Publications (identifier: Q9JKS4-6)
Modified residuei112PhosphoserineCombined sources1
Modified residuei288PhosphoserineCombined sources1
Isoform 51 Publication (identifier: Q9JKS4-5)
Modified residuei327PhosphoserineCombined sources1
Isoform 32 Publications (identifier: Q9JKS4-3)
Modified residuei330Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9JKS4

PeptideAtlas

More...PeptideAtlasi		Q9JKS4

PRoteomics IDEntifications database

More...PRIDEi		Q9JKS4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		264925 [Q9JKS4-1]
264926 [Q9JKS4-2]
264927 [Q9JKS4-3]
264928 [Q9JKS4-4]
264929 [Q9JKS4-5]
264930 [Q9JKS4-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9JKS4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9JKS4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed primarily in adult heart and skeletal muscle, and detected at lower levels in lung. Isoforms are expressed in a tissue-specific manner. Isoform 1, isoform 3 and isoform 5 are expressed in heart, whereas isoform 2, isoform 4 and isoform 6 are expressed in skeletal muscle.4 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Initially expressed in a myocardium-specific manner at 8.5-9 dpc and remains cardiac-restricted until day 12. Strongly expressed throughout heart in all stages examined. At 12.5 dpc expressed at low levels in non-cardiac striated muscles. By 14.5 dpc expressed at high levels in both cardiac and skeletal muscle, and also strongly expressed in striated muscles of tongue, thoracic and abdominal muscles, leg and diaphragm. The various isoforms are developmentally regulated in both skeletal and cardiac muscle. Isoform 5 and isoform 6, which are barely detectable during embryogenesis are up-regulated postnatally. In heart, isoform 3 is up-regulated developmentally, whereas the predominant isoform 1 is expressed throughout development and into adulthood. In skeletal muscle, the predominant isoform 2 is gradually replaced by isoform 4 postnatally.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000021798, Expressed in gastrocnemius medialis and 291 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9JKS4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9JKS4, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts via its LIM domains with various PKC isoforms.

Interacts via its PDZ domain with the ACTN2 C-terminal region.

Interacts with MYOZ1, MYOZ2 and MYOZ3.

By similarity1 Publication

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		204912, 17 interactors

Protein interaction database and analysis system

More...IntActi		Q9JKS4, 4 interactors

Molecular INTeraction database

More...MINTi		Q9JKS4

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000022327

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9JKS4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1723
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q9JKS4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9JKS4

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9JKS4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 84PDZPROSITE-ProRule annotationAdd BLAST84
Domaini545 – 603LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST59
Domaini604 – 663LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60
Domaini664 – 723LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni89 – 134DisorderedSequence analysisAdd BLAST46
Regioni164 – 193DisorderedSequence analysisAdd BLAST30
Regioni280 – 423DisorderedSequence analysisAdd BLAST144
Regioni436 – 525DisorderedSequence analysisAdd BLAST90

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi170 – 193Polar residuesSequence analysisAdd BLAST24
Compositional biasi300 – 326Polar residuesSequence analysisAdd BLAST27
Compositional biasi398 – 419Polar residuesSequence analysisAdd BLAST22
Compositional biasi436 – 466Pro residuesSequence analysisAdd BLAST31
Compositional biasi484 – 513Polar residuesSequence analysisAdd BLAST30

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1703, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154877

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_038114_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9JKS4

Identification of Orthologs from Complete Genome Data

More...OMAi		SNVYCER

Database of Orthologous Groups

More...OrthoDBi		1013114at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9JKS4

TreeFam database of animal gene trees

More...TreeFami		TF106408

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.42.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR031847, DUF4749
IPR001478, PDZ
IPR036034, PDZ_sf
IPR006643, Zasp-like_motif
IPR001781, Znf_LIM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF15936, DUF4749, 1 hit
PF00412, LIM, 3 hits
PF00595, PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00132, LIM, 3 hits
SM00228, PDZ, 1 hit
SM00735, ZM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50156, SSF50156, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 3 hits
PS50106, PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9JKS4-1) [UniParc]FASTAAdd to basket
Also known as: Cypher1c1 Publication, Oracle 11 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSYSVTLTGP GPWGFRLQGG KDFNMPLTIS RITPGSKAAQ SQLSQGDLVV 
        60         70         80         90        100
AIDGVNTDTM THLEAQNKIK SASYNLSLTL QKSKRPIPIS TTAPPIQSPL 
       110        120        130        140        150
PVIPHQKDPA LDTNGSLATP SPSPEARASP GALEFGDTFS SSFSQTSVCS 
       160        170        180        190        200
PLMEASGPVL PLGSPVAKAS SEGAQGSVSP KVLPGPSQPR QYNNPIGLYS 
       210        220        230        240        250
AETLREMAQM YQMSLRGKAS GAGLLGGSLP VKDLAVDSAS PVYQAVIKTQ 
       260        270        280        290        300
SKPEDEADEW ARRSSNLQSR SFRILAQMTG TEYMQDPDEE ALRRSSTPIE 
       310        320        330        340        350
HAPVCTSQAT SPLLPASAQS PAAASPIAAS PTLATAAATH AAAASAAGPA 
       360        370        380        390        400
ASPVENPRPQ ASAYSPAAAA SPAPSAHTSY SEGPAAPAPK PRVVTTASIR 
       410        420        430        440        450
PSVYQPVPAS SYSPSPGANY SPTPYTPSPA PAYTPSPAPT YTPSPAPTYS 
       460        470        480        490        500
PSPAPAYTPS PAPNYTPTPS AAYSGGPSES ASRPPWVTDD SFSQKFAPGK 
       510        520        530        540        550
STTTVSKQTL PRGAPAYNPT GPQVTPLARG TFQRAERFPA SSRTPLCGHC 
       560        570        580        590        600
NNVIRGPFLV AMGRSWHPEE FNCAYCKTSL ADVCFVEEQN NVYCERCYEQ 
       610        620        630        640        650
FFAPICAKCN TKIMGEVMHA LRQTWHTTCF VCAACKKPFG NSLFHMEDGE 
       660        670        680        690        700
PYCEKDYINL FSTKCHGCDF PVEAGDKFIE ALGHTWHDTC FICAVCHVNL 
       710        720 
EGQPFYSKKD KPLCKKHAHA INV
Length:723
Mass (Da):76,432
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCC67D38AC2FFA6B6
GO
Isoform 21 Publication (identifier: Q9JKS4-2) [UniParc]FASTAAdd to basket
Also known as: Cypher1s1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA

Show »
Length:684
Mass (Da):72,752
Checksum:iB8969D96ECC7C7C5
GO
Isoform 32 Publications (identifier: Q9JKS4-3) [UniParc]FASTAAdd to basket
Also known as: Cypher3c1 Publication, Oracle 21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     296-357: Missing.

Show »
Length:661
Mass (Da):70,751
Checksum:i5DEFEEE78D45532F
GO
Isoform 41 Publication (identifier: Q9JKS4-4) [UniParc]FASTAAdd to basket
Also known as: Cypher3s1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA
     296-357: Missing.

Show »
Length:622
Mass (Da):67,071
Checksum:iABC92BB80C3B9903
GO
Isoform 51 Publication (identifier: Q9JKS4-5) [UniParc]FASTAAdd to basket
Also known as: Cypher2c1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     296-327: STPIEHAPVCTSQATSPLLPASAQSPAAASPI → RERFETERNSPRFAKLRNWHHGLSAQILNVKS
     328-723: Missing.

Show »
Length:327
Mass (Da):35,108
Checksum:i603BEF5D6152B848
GO
Isoform 62 Publications (identifier: Q9JKS4-6) [UniParc]FASTAAdd to basket
Also known as: Cypher2s1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     108-227: DPALDTNGSL...KASGAGLLGG → VVANSPANAD...SDFSGASPLA
     296-327: STPIEHAPVCTSQATSPLLPASAQSPAAASPI → RERFETERNSPRFAKLRNWHHGLSAQILNVKS
     328-723: Missing.

Show »
Length:288
Mass (Da):31,427
Checksum:i65B11275409291B6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PYJ9E9PYJ9_MOUSE
LIM domain-binding protein 3
Ldb3
679Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB23128 differs from that shown. Sequencing errors.Curated
The sequence BAD32258 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti108 – 145DPALD…SSFSQ → VVANSPANADYQERFNPSVL KGLSSVLKGLSSVHPQAH in BAB23128 (PubMed:16141072).CuratedAdd BLAST38
Sequence conflicti450S → T in AAD42950 (PubMed:10391924).Curated1
Sequence conflicti450S → T in AAO26188 (PubMed:12499364).Curated1
Sequence conflicti450S → T in AAO26189 (PubMed:12499364).Curated1
Sequence conflicti512R → W in BAD32258 (PubMed:15368895).Curated1
Isoform 21 Publication (identifier: Q9JKS4-2)
Sequence conflicti176 – 188AQGSD…ASPLA → AQGSDFSG in AAO26189 (PubMed:12499364).CuratedAdd BLAST13

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_051903108 – 227DPALD…GLLGG → VVANSPANADYQERFNPSVL KDSALSTHKPIEVKGLGGKA TIIHAQYNTPISMYSQDAIM DAIAGQAQAQGSDFSGASPL A in isoform 2, isoform 4 and isoform 6. 5 PublicationsAdd BLAST120
Alternative sequenceiVSP_051904296 – 357Missing in isoform 3 and isoform 4. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_051905296 – 327STPIE…AASPI → RERFETERNSPRFAKLRNWH HGLSAQILNVKS in isoform 5 and isoform 6. 5 PublicationsAdd BLAST32
Alternative sequenceiVSP_051906328 – 723Missing in isoform 5 and isoform 6. 5 PublicationsAdd BLAST396

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF114378 mRNA Translation: AAD42950.2
AF114379 mRNA Translation: AAD42951.2
AJ005621 mRNA Translation: CAB46747.1
AF228057 mRNA Translation: AAF33847.1
AF228058 mRNA Translation: AAF33848.1
AY206011 mRNA Translation: AAO26187.1
AY206012 mRNA Translation: AAO26188.1
AY206013 mRNA Translation: AAO26189.1
AY206015 mRNA Translation: AAO26190.1
AK172980 mRNA Translation: BAD32258.1 Different initiation.
AK004020 mRNA Translation: BAB23128.1 Sequence problems.
AK137181 mRNA Translation: BAE23262.1
AK142292 mRNA Translation: BAE25016.1
BC099596 mRNA Translation: AAH99596.1
BC138793 mRNA Translation: AAI38794.1
BC145420 mRNA Translation: AAI45421.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS26940.1 [Q9JKS4-3]
CCDS26941.1 [Q9JKS4-1]
CCDS26942.1 [Q9JKS4-5]
CCDS36879.1 [Q9JKS4-2]
CCDS88626.1 [Q9JKS4-4]
CCDS88627.1 [Q9JKS4-6]

NCBI Reference Sequences

More...RefSeqi		NP_001034160.1, NM_001039071.2 [Q9JKS4-3]
NP_001034161.1, NM_001039072.2
NP_001034162.1, NM_001039073.2 [Q9JKS4-4]
NP_001034163.1, NM_001039074.2 [Q9JKS4-2]
NP_001034164.1, NM_001039075.2 [Q9JKS4-6]
NP_001034165.1, NM_001039076.2 [Q9JKS4-5]
NP_036048.3, NM_011918.4 [Q9JKS4-1]
XP_006519080.1, XM_006519017.3 [Q9JKS4-2]
XP_017171508.1, XM_017316019.1 [Q9JKS4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000022327; ENSMUSP00000022327; ENSMUSG00000021798 [Q9JKS4-1]
ENSMUST00000022328; ENSMUSP00000022328; ENSMUSG00000021798 [Q9JKS4-3]
ENSMUST00000022330; ENSMUSP00000022330; ENSMUSG00000021798 [Q9JKS4-5]
ENSMUST00000090040; ENSMUSP00000087494; ENSMUSG00000021798 [Q9JKS4-2]
ENSMUST00000227819; ENSMUSP00000154119; ENSMUSG00000021798 [Q9JKS4-6]
ENSMUST00000228044; ENSMUSP00000154758; ENSMUSG00000021798 [Q9JKS4-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		24131

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:24131

UCSC genome browser

More...UCSCi		uc007taz.1, mouse [Q9JKS4-2]
uc007tba.1, mouse [Q9JKS4-4]
uc007tbc.1, mouse [Q9JKS4-1]
uc007tbd.1, mouse [Q9JKS4-3]
uc007tbe.1, mouse [Q9JKS4-6]
uc007tbf.1, mouse [Q9JKS4-5]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114378 mRNA Translation: AAD42950.2
AF114379 mRNA Translation: AAD42951.2
AJ005621 mRNA Translation: CAB46747.1
AF228057 mRNA Translation: AAF33847.1
AF228058 mRNA Translation: AAF33848.1
AY206011 mRNA Translation: AAO26187.1
AY206012 mRNA Translation: AAO26188.1
AY206013 mRNA Translation: AAO26189.1
AY206015 mRNA Translation: AAO26190.1
AK172980 mRNA Translation: BAD32258.1 Different initiation.
AK004020 mRNA Translation: BAB23128.1 Sequence problems.
AK137181 mRNA Translation: BAE23262.1
AK142292 mRNA Translation: BAE25016.1
BC099596 mRNA Translation: AAH99596.1
BC138793 mRNA Translation: AAI38794.1
BC145420 mRNA Translation: AAI45421.1
CCDSiCCDS26940.1 [Q9JKS4-3]
CCDS26941.1 [Q9JKS4-1]
CCDS26942.1 [Q9JKS4-5]
CCDS36879.1 [Q9JKS4-2]
CCDS88626.1 [Q9JKS4-4]
CCDS88627.1 [Q9JKS4-6]
RefSeqiNP_001034160.1, NM_001039071.2 [Q9JKS4-3]
NP_001034161.1, NM_001039072.2
NP_001034162.1, NM_001039073.2 [Q9JKS4-4]
NP_001034163.1, NM_001039074.2 [Q9JKS4-2]
NP_001034164.1, NM_001039075.2 [Q9JKS4-6]
NP_001034165.1, NM_001039076.2 [Q9JKS4-5]
NP_036048.3, NM_011918.4 [Q9JKS4-1]
XP_006519080.1, XM_006519017.3 [Q9JKS4-2]
XP_017171508.1, XM_017316019.1 [Q9JKS4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WJLNMR-A1-83[»]
BMRBiQ9JKS4
SMRiQ9JKS4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi204912, 17 interactors
IntActiQ9JKS4, 4 interactors
MINTiQ9JKS4
STRINGi10090.ENSMUSP00000022327

PTM databases

iPTMnetiQ9JKS4
PhosphoSitePlusiQ9JKS4

Proteomic databases

PaxDbiQ9JKS4
PeptideAtlasiQ9JKS4
PRIDEiQ9JKS4
ProteomicsDBi264925 [Q9JKS4-1]
264926 [Q9JKS4-2]
264927 [Q9JKS4-3]
264928 [Q9JKS4-4]
264929 [Q9JKS4-5]
264930 [Q9JKS4-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		15974, 255 antibodies

The DNASU plasmid repository

More...DNASUi		24131

Genome annotation databases

EnsembliENSMUST00000022327; ENSMUSP00000022327; ENSMUSG00000021798 [Q9JKS4-1]
ENSMUST00000022328; ENSMUSP00000022328; ENSMUSG00000021798 [Q9JKS4-3]
ENSMUST00000022330; ENSMUSP00000022330; ENSMUSG00000021798 [Q9JKS4-5]
ENSMUST00000090040; ENSMUSP00000087494; ENSMUSG00000021798 [Q9JKS4-2]
ENSMUST00000227819; ENSMUSP00000154119; ENSMUSG00000021798 [Q9JKS4-6]
ENSMUST00000228044; ENSMUSP00000154758; ENSMUSG00000021798 [Q9JKS4-4]
GeneIDi24131
KEGGimmu:24131
UCSCiuc007taz.1, mouse [Q9JKS4-2]
uc007tba.1, mouse [Q9JKS4-4]
uc007tbc.1, mouse [Q9JKS4-1]
uc007tbd.1, mouse [Q9JKS4-3]
uc007tbe.1, mouse [Q9JKS4-6]
uc007tbf.1, mouse [Q9JKS4-5]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		11155
MGIiMGI:1344412, Ldb3

Rodent Unidentified Gene-Encoded large proteins database

More...Rougei		Search...

Phylogenomic databases

eggNOGiKOG1703, Eukaryota
GeneTreeiENSGT00940000154877
HOGENOMiCLU_038114_0_0_1
InParanoidiQ9JKS4
OMAiSNVYCER
OrthoDBi1013114at2759
PhylomeDBiQ9JKS4
TreeFamiTF106408

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		24131, 0 hits in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Ldb3, mouse
EvolutionaryTraceiQ9JKS4

Protein Ontology

More...PROi		PR:Q9JKS4
RNActiQ9JKS4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000021798, Expressed in gastrocnemius medialis and 291 other tissues
ExpressionAtlasiQ9JKS4, baseline and differential
GenevisibleiQ9JKS4, MM

Family and domain databases

Gene3Di2.30.42.10, 1 hit
InterProiView protein in InterPro
IPR031847, DUF4749
IPR001478, PDZ
IPR036034, PDZ_sf
IPR006643, Zasp-like_motif
IPR001781, Znf_LIM
PfamiView protein in Pfam
PF15936, DUF4749, 1 hit
PF00412, LIM, 3 hits
PF00595, PDZ, 1 hit
SMARTiView protein in SMART
SM00132, LIM, 3 hits
SM00228, PDZ, 1 hit
SM00735, ZM, 1 hit
SUPFAMiSSF50156, SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 3 hits
PS50106, PDZ, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLDB3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JKS4
Secondary accession number(s): B2RSB0
, B7ZNT6, Q6A038, Q811P2, Q811P3, Q811P4, Q811P5, Q9D130, Q9JKS3, Q9R0Z1, Q9WVH1, Q9WVH2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: October 1, 2000
Last modified: June 2, 2021
This is version 160 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again