Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Profilin-2

Gene

Pfn2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

ReactomeiR-MMU-376176 Signaling by ROBO receptors
R-MMU-5663220 RHO GTPases Activate Formins

Names & Taxonomyi

Protein namesi
Recommended name:
Profilin-2
Alternative name(s):
Profilin II
Gene namesi
Name:Pfn2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:97550 Pfn2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001995762 – 140Profilin-2Add BLAST139

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ9JJV2
PeptideAtlasiQ9JJV2
PRIDEiQ9JJV2

2D gel databases

REPRODUCTION-2DPAGEiQ9JJV2
UCD-2DPAGEiQ9JJV2

PTM databases

iPTMnetiQ9JJV2
PhosphoSitePlusiQ9JJV2

Expressioni

Tissue specificityi

Isoform IIa is the main isoform and is abundant in brain. Isoform IIb is a minor isoform.

Gene expression databases

BgeeiENSMUSG00000027805 Expressed in 287 organ(s), highest expression level in CA1 field of hippocampus
CleanExiMM_PFN2
ExpressionAtlasiQ9JJV2 baseline and differential
GenevisibleiQ9JJV2 MM

Interactioni

Subunit structurei

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio (By similarity). Interacts with PFN2 (PubMed:19403918).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Dnm1P390532EBI-990256,EBI-397785

GO - Molecular functioni

Protein-protein interaction databases

BioGridi202127, 14 interactors
CORUMiQ9JJV2
IntActiQ9JJV2, 6 interactors
MINTiQ9JJV2
STRINGi10090.ENSMUSP00000068890

Structurei

Secondary structure

1140
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9JJV2
SMRiQ9JJV2
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9JJV2

Family & Domainsi

Sequence similaritiesi

Belongs to the profilin family.Curated

Phylogenomic databases

eggNOGiKOG1755 Eukaryota
ENOG41126PD LUCA
GeneTreeiENSGT00390000010143
HOGENOMiHOG000171592
HOVERGENiHBG053683
InParanoidiQ9JJV2
KOiK05759
OMAiMDNLMCD
OrthoDBiEOG091G0TWH
PhylomeDBiQ9JJV2
TreeFamiTF331744

Family and domain databases

CDDicd00148 PROF, 1 hit
InterProiView protein in InterPro
IPR005455 PFN
IPR029891 PFN2
IPR036140 PFN_sf
IPR005454 Profilin1/2/3_vertebrate
IPR027310 Profilin_CS
PANTHERiPTHR13936:SF15 PTHR13936:SF15, 1 hit
PfamiView protein in Pfam
PF00235 Profilin, 1 hit
PRINTSiPR00392 PROFILIN
PR01639 PROFILINMAML
SMARTiView protein in SMART
SM00392 PROF, 1 hit
SUPFAMiSSF55770 SSF55770, 1 hit
PROSITEiView protein in PROSITE
PS00414 PROFILIN, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9JJV2-1) [UniParc]FASTAAdd to basket
Also known as: IIa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPVEIDM
60 70 80 90 100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN
110 120 130 140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF
Length:140
Mass (Da):15,032
Last modified:January 23, 2007 - v3
Checksum:iE780BF62E9EC8476
GO
Isoform 2 (identifier: Q9JJV2-2) [UniParc]FASTAAdd to basket
Also known as: IIb

The sequence of this isoform differs from the canonical sequence as follows:
     109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHAGTINKKTYELALYLKRSVTNLYLAS

Show »
Length:146
Mass (Da):15,738
Checksum:i415EBAD1E92842BC
GO
Isoform 3 (identifier: Q9JJV2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: Missing.

Note: No experimental confirmation available.
Show »
Length:91
Mass (Da):9,798
Checksum:i3E34B08C5626DB2E
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YWS3D3YWS3_MOUSE
Profilin
Pfn2
110Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti36A → G in AAG09753 (PubMed:11027290).Curated1
Sequence conflicti36A → G in AAG09756 (PubMed:11027290).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0247361 – 49Missing in isoform 3. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_005218109 – 140VLVFV…RDSGF → ALVIVMGKEGVHAGTINKKT YELALYLKRSVTNLYLAS in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ272203 mRNA Translation: CAB87382.1
AF237680 Genomic DNA Translation: AAG09753.1
AF237680 Genomic DNA Translation: AAG09755.1
AF237680 Genomic DNA Translation: AAG09756.1
AK132651 mRNA Translation: BAE21281.1
AK164145 mRNA Translation: BAE37648.1
BC024363 mRNA Translation: AAH24363.1
CCDSiCCDS17364.1 [Q9JJV2-1]
RefSeqiNP_062283.1, NM_019410.3 [Q9JJV2-1]
UniGeneiMm.271744

Genome annotation databases

EnsembliENSMUST00000066882; ENSMUSP00000068890; ENSMUSG00000027805 [Q9JJV2-1]
ENSMUST00000119344; ENSMUSP00000112391; ENSMUSG00000027805 [Q9JJV2-3]
ENSMUST00000122210; ENSMUSP00000113526; ENSMUSG00000027805 [Q9JJV2-3]
GeneIDi18645
KEGGimmu:18645
UCSCiuc008phm.1 mouse [Q9JJV2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ272203 mRNA Translation: CAB87382.1
AF237680 Genomic DNA Translation: AAG09753.1
AF237680 Genomic DNA Translation: AAG09755.1
AF237680 Genomic DNA Translation: AAG09756.1
AK132651 mRNA Translation: BAE21281.1
AK164145 mRNA Translation: BAE37648.1
BC024363 mRNA Translation: AAH24363.1
CCDSiCCDS17364.1 [Q9JJV2-1]
RefSeqiNP_062283.1, NM_019410.3 [Q9JJV2-1]
UniGeneiMm.271744

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2V8CX-ray1.98A1-140[»]
2V8FX-ray1.10A/B1-140[»]
ProteinModelPortaliQ9JJV2
SMRiQ9JJV2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202127, 14 interactors
CORUMiQ9JJV2
IntActiQ9JJV2, 6 interactors
MINTiQ9JJV2
STRINGi10090.ENSMUSP00000068890

PTM databases

iPTMnetiQ9JJV2
PhosphoSitePlusiQ9JJV2

2D gel databases

REPRODUCTION-2DPAGEiQ9JJV2
UCD-2DPAGEiQ9JJV2

Proteomic databases

PaxDbiQ9JJV2
PeptideAtlasiQ9JJV2
PRIDEiQ9JJV2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000066882; ENSMUSP00000068890; ENSMUSG00000027805 [Q9JJV2-1]
ENSMUST00000119344; ENSMUSP00000112391; ENSMUSG00000027805 [Q9JJV2-3]
ENSMUST00000122210; ENSMUSP00000113526; ENSMUSG00000027805 [Q9JJV2-3]
GeneIDi18645
KEGGimmu:18645
UCSCiuc008phm.1 mouse [Q9JJV2-1]

Organism-specific databases

CTDi5217
MGIiMGI:97550 Pfn2

Phylogenomic databases

eggNOGiKOG1755 Eukaryota
ENOG41126PD LUCA
GeneTreeiENSGT00390000010143
HOGENOMiHOG000171592
HOVERGENiHBG053683
InParanoidiQ9JJV2
KOiK05759
OMAiMDNLMCD
OrthoDBiEOG091G0TWH
PhylomeDBiQ9JJV2
TreeFamiTF331744

Enzyme and pathway databases

ReactomeiR-MMU-376176 Signaling by ROBO receptors
R-MMU-5663220 RHO GTPases Activate Formins

Miscellaneous databases

ChiTaRSiPfn2 mouse
EvolutionaryTraceiQ9JJV2
PROiPR:Q9JJV2
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027805 Expressed in 287 organ(s), highest expression level in CA1 field of hippocampus
CleanExiMM_PFN2
ExpressionAtlasiQ9JJV2 baseline and differential
GenevisibleiQ9JJV2 MM

Family and domain databases

CDDicd00148 PROF, 1 hit
InterProiView protein in InterPro
IPR005455 PFN
IPR029891 PFN2
IPR036140 PFN_sf
IPR005454 Profilin1/2/3_vertebrate
IPR027310 Profilin_CS
PANTHERiPTHR13936:SF15 PTHR13936:SF15, 1 hit
PfamiView protein in Pfam
PF00235 Profilin, 1 hit
PRINTSiPR00392 PROFILIN
PR01639 PROFILINMAML
SMARTiView protein in SMART
SM00392 PROF, 1 hit
SUPFAMiSSF55770 SSF55770, 1 hit
PROSITEiView protein in PROSITE
PS00414 PROFILIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPROF2_MOUSE
AccessioniPrimary (citable) accession number: Q9JJV2
Secondary accession number(s): Q3TPT7
, Q3V171, Q9ES48, Q9ES49, Q9ES50
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 151 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again