Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (29 Sep 2021)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Profilin-2

Gene

Pfn2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-376176, Signaling by ROBO receptors
R-MMU-5663220, RHO GTPases Activate Formins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Profilin-2
Alternative name(s):
Profilin II
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pfn2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:97550, Pfn2

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000027805

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001995762 – 140Profilin-2Add BLAST139

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9JJV2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9JJV2

PeptideAtlas

More...
PeptideAtlasi
Q9JJV2

PRoteomics IDEntifications database

More...
PRIDEi
Q9JJV2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
291596 [Q9JJV2-1]
291597 [Q9JJV2-2]
291598 [Q9JJV2-3]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
Q9JJV2

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
Q9JJV2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9JJV2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9JJV2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9JJV2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform IIa is the main isoform and is abundant in brain. Isoform IIb is a minor isoform.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000027805, Expressed in CA1 field of hippocampus and 308 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9JJV2, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Occurs in many kinds of cells as a complex with monomeric actin in a 1:1 ratio (By similarity).

Interacts with PFN2 (PubMed:19403918).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
202127, 24 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9JJV2

Protein interaction database and analysis system

More...
IntActi
Q9JJV2, 5 interactors

Molecular INTeraction database

More...
MINTi
Q9JJV2

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000068890

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9JJV2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1140
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q9JJV2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9JJV2

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9JJV2

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the profilin family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1755, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153664

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_123405_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9JJV2

Identification of Orthologs from Complete Genome Data

More...
OMAi
KAPASHC

Database of Orthologous Groups

More...
OrthoDBi
1428600at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9JJV2

TreeFam database of animal gene trees

More...
TreeFami
TF331744

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00148, PROF, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005455, PFN
IPR029891, PFN2
IPR036140, PFN_sf
IPR005454, Profilin1/2/3_vertebrate
IPR027310, Profilin_CS

The PANTHER Classification System

More...
PANTHERi
PTHR13936:SF15, PTHR13936:SF15, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00235, Profilin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00392, PROFILIN
PR01639, PROFILINMAML

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00392, PROF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55770, SSF55770, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00414, PROFILIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9JJV2-1) [UniParc]FASTAAdd to basket
Also known as: IIa

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGWQSYVDN LMCDGCCQEA AIVGYCDAKY VWAATAGGVF QSITPVEIDM
60 70 80 90 100
IVGKDREGFF TNGLTLGAKK CSVIRDSLYV DGDCTMDIRT KSQGGEPTYN
110 120 130 140
VAVGRAGRVL VFVMGKEGVH GGGLNKKAYS MAKYLRDSGF
Length:140
Mass (Da):15,032
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE780BF62E9EC8476
GO
Isoform 2 (identifier: Q9JJV2-2) [UniParc]FASTAAdd to basket
Also known as: IIb

The sequence of this isoform differs from the canonical sequence as follows:
     109-140: VLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF → ALVIVMGKEGVHAGTINKKTYELALYLKRSVTNLYLAS

Show »
Length:146
Mass (Da):15,738
Checksum:i415EBAD1E92842BC
GO
Isoform 3 (identifier: Q9JJV2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: Missing.

Show »
Length:91
Mass (Da):9,798
Checksum:i3E34B08C5626DB2E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YWS3D3YWS3_MOUSE
Profilin
Pfn2
110Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti36A → G in AAG09753 (PubMed:11027290).Curated1
Sequence conflicti36A → G in AAG09756 (PubMed:11027290).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0247361 – 49Missing in isoform 3. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_005218109 – 140VLVFV…RDSGF → ALVIVMGKEGVHAGTINKKT YELALYLKRSVTNLYLAS in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ272203 mRNA Translation: CAB87382.1
AF237680 Genomic DNA Translation: AAG09753.1
AF237680 Genomic DNA Translation: AAG09755.1
AF237680 Genomic DNA Translation: AAG09756.1
AK132651 mRNA Translation: BAE21281.1
AK164145 mRNA Translation: BAE37648.1
BC024363 mRNA Translation: AAH24363.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS17364.1 [Q9JJV2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_062283.1, NM_019410.3 [Q9JJV2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000066882; ENSMUSP00000068890; ENSMUSG00000027805 [Q9JJV2-1]
ENSMUST00000119344; ENSMUSP00000112391; ENSMUSG00000027805 [Q9JJV2-3]
ENSMUST00000122210; ENSMUSP00000113526; ENSMUSG00000027805 [Q9JJV2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
18645

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:18645

UCSC genome browser

More...
UCSCi
uc008phm.1, mouse [Q9JJV2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ272203 mRNA Translation: CAB87382.1
AF237680 Genomic DNA Translation: AAG09753.1
AF237680 Genomic DNA Translation: AAG09755.1
AF237680 Genomic DNA Translation: AAG09756.1
AK132651 mRNA Translation: BAE21281.1
AK164145 mRNA Translation: BAE37648.1
BC024363 mRNA Translation: AAH24363.1
CCDSiCCDS17364.1 [Q9JJV2-1]
RefSeqiNP_062283.1, NM_019410.3 [Q9JJV2-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2V8CX-ray1.98A1-140[»]
2V8FX-ray1.10A/B1-140[»]
BMRBiQ9JJV2
SMRiQ9JJV2
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi202127, 24 interactors
CORUMiQ9JJV2
IntActiQ9JJV2, 5 interactors
MINTiQ9JJV2
STRINGi10090.ENSMUSP00000068890

PTM databases

iPTMnetiQ9JJV2
PhosphoSitePlusiQ9JJV2
SwissPalmiQ9JJV2

2D gel databases

REPRODUCTION-2DPAGEiQ9JJV2
UCD-2DPAGEiQ9JJV2

Proteomic databases

jPOSTiQ9JJV2
PaxDbiQ9JJV2
PeptideAtlasiQ9JJV2
PRIDEiQ9JJV2
ProteomicsDBi291596 [Q9JJV2-1]
291597 [Q9JJV2-2]
291598 [Q9JJV2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33583, 265 antibodies

The DNASU plasmid repository

More...
DNASUi
18645

Genome annotation databases

EnsembliENSMUST00000066882; ENSMUSP00000068890; ENSMUSG00000027805 [Q9JJV2-1]
ENSMUST00000119344; ENSMUSP00000112391; ENSMUSG00000027805 [Q9JJV2-3]
ENSMUST00000122210; ENSMUSP00000113526; ENSMUSG00000027805 [Q9JJV2-3]
GeneIDi18645
KEGGimmu:18645
UCSCiuc008phm.1, mouse [Q9JJV2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5217
MGIiMGI:97550, Pfn2
VEuPathDBiHostDB:ENSMUSG00000027805

Phylogenomic databases

eggNOGiKOG1755, Eukaryota
GeneTreeiENSGT00940000153664
HOGENOMiCLU_123405_1_0_1
InParanoidiQ9JJV2
OMAiKAPASHC
OrthoDBi1428600at2759
PhylomeDBiQ9JJV2
TreeFamiTF331744

Enzyme and pathway databases

ReactomeiR-MMU-376176, Signaling by ROBO receptors
R-MMU-5663220, RHO GTPases Activate Formins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
18645, 0 hits in 62 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Pfn2, mouse
EvolutionaryTraceiQ9JJV2

Protein Ontology

More...
PROi
PR:Q9JJV2
RNActiQ9JJV2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000027805, Expressed in CA1 field of hippocampus and 308 other tissues
GenevisibleiQ9JJV2, MM

Family and domain databases

CDDicd00148, PROF, 1 hit
InterProiView protein in InterPro
IPR005455, PFN
IPR029891, PFN2
IPR036140, PFN_sf
IPR005454, Profilin1/2/3_vertebrate
IPR027310, Profilin_CS
PANTHERiPTHR13936:SF15, PTHR13936:SF15, 1 hit
PfamiView protein in Pfam
PF00235, Profilin, 1 hit
PRINTSiPR00392, PROFILIN
PR01639, PROFILINMAML
SMARTiView protein in SMART
SM00392, PROF, 1 hit
SUPFAMiSSF55770, SSF55770, 1 hit
PROSITEiView protein in PROSITE
PS00414, PROFILIN, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPROF2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JJV2
Secondary accession number(s): Q3TPT7
, Q3V171, Q9ES48, Q9ES49, Q9ES50
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: January 23, 2007
Last modified: September 29, 2021
This is version 169 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again