Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GDNF family receptor alpha-4

Gene

Gfra4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Receptor for persephin. Mediates the GDNF-induced autophosphorylation and activation of the RET receptor. May be important in C-cell development and, in the postnatal development of the adrenal medulla.

GO - Molecular functioni

  • coreceptor activity Source: MGI
  • glial cell-derived neurotrophic factor receptor activity Source: MGI

GO - Biological processi

  • negative regulation of ossification Source: MGI
  • transmembrane receptor protein tyrosine kinase signaling pathway Source: MGI

Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

ReactomeiR-MMU-5673001 RAF/MAP kinase cascade
R-MMU-8853659 RET signaling

Names & Taxonomyi

Protein namesi
Recommended name:
GDNF family receptor alpha-4
Short name:
GDNF receptor alpha-4
Short name:
GDNFR-alpha-4
Short name:
GFR-alpha-4
Alternative name(s):
Persephin receptor
Gene namesi
Name:Gfra4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1341873 Gfra4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000001079524 – 237GDNF family receptor alpha-4Add BLAST214
PropeptideiPRO_0000010796238 – 260Removed in mature formSequence analysisAdd BLAST23

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi184N-linked (GlcNAc...) asparagineSequence analysis1
Lipidationi237GPI-anchor amidated threonineSequence analysis1

Keywords - PTMi

Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiQ9JJT2
PRIDEiQ9JJT2

Expressioni

Tissue specificityi

Expressed in many tissues including adrenal medulla, brain neurons, with highest levels in the cerebral cortex and hippocampus. Moderate levels found in the gut circular muscle and myenteric ganglia as well as in other peripheral ganglia, including the sensory dorsal root and trigeminal as well as superior cervical and sympathetic chain ganglia. Isoform a1, isoform a2, isoform b1 and isoform b2 are exclusively found in the thyroid, parthyroid and pituitary glands.

Developmental stagei

Expressed in several tissues at different embryonic and postnatal stages such as the condensing mesenchyme of developing bones and developing nervous system. Expressed in the developing pituitary gland from E16 and in developing thyroid C-cells from E14. In the ventral spinal cord, levels decline before birth. In the parathyroid, levels first detected in 3- to 6-week-old mice with high expression. In the adrenal medulla, expressed only in newborn, postnatal (P08) and adult mice. Isoform a1 and isoform b1 are prefentially expressed in 3-week-old thyroid, isoform a2 and isoform b2 in newborn and 6-week-old thyroid glands as well as in postnatal adrenal and pituitary glands.

Gene expression databases

BgeeiENSMUSG00000027316 Expressed in 52 organ(s), highest expression level in sympathetic ganglion
ExpressionAtlasiQ9JJT2 baseline and differential
GenevisibleiQ9JJT2 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000028787

Structurei

3D structure databases

ProteinModelPortaliQ9JJT2
SMRiQ9JJT2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the GDNFR family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J23G Eukaryota
ENOG4111972 LUCA
GeneTreeiENSGT00550000074579
HOVERGENiHBG051727
InParanoidiQ9JJT2
OMAiTFVPACA
PhylomeDBiQ9JJT2
TreeFamiTF331647

Family and domain databases

InterProiView protein in InterPro
IPR016017 GDNF/GAS1
IPR037193 GDNF_alpha
IPR003438 GDNF_rcpt
PANTHERiPTHR10269 PTHR10269, 1 hit
PfamiView protein in Pfam
PF02351 GDNF, 2 hits
PRINTSiPR01316 GDNFRECEPTOR
SMARTiView protein in SMART
SM00907 GDNF, 2 hits
SUPFAMiSSF110035 SSF110035, 1 hit

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Tissue-specific and, developmentally regulated splicing.
Isoform a1 (identifier: Q9JJT2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAHCMESALL LLLLLGSASF TDGNRCVDAA EACTADERCQ QLRSEYVARC
60 70 80 90 100
LGRAAPGGRP GPGGCVRSRC RRALRRFFAR GPPALTHALL FCGCEGSACA
110 120 130 140 150
ERRRQTFAPA CAFSGPGLVP PSCLEPLERC ERSRLCRPRL LAFQASCAPA
160 170 180 190 200
PGSRDRCPEE GGPRCLRVYA GLIGTVVTPN YLDNVSARVA PWCGCAASGN
210 220 230 240 250
RREECEAFRK LFTRNPCLDG AIQAFDSLQP SVLQDQTAGC CFPRVSWLYA
260
LTALALQALL
Length:260
Mass (Da):27,990
Last modified:April 23, 2003 - v2
Checksum:i2679BBC789E38075
GO
Isoform a2 (identifier: Q9JJT2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-260: VSWLYALTALALQALL → ARHEWPEKSWRQKQSLFCPNAQGVLAVCTHCPGSPGPALIRNMNRGRHS

Show »
Length:293
Mass (Da):31,755
Checksum:i4A515A4D590328F3
GO
Isoform a3 (identifier: Q9JJT2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     138-190: PRLLAFQASC...YLDNVSARVA → CVRAGRAGPL...RVVCASTQAS
     191-260: Missing.

Show »
Length:190
Mass (Da):20,183
Checksum:iDB36AB0C6FB88618
GO
Isoform b1 (identifier: Q9JJT2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MAHCMESALLLLLLLGS → MLRRAHLMDERPGQAIFLGLGSQRGS

Note: Alternative N-terminal. Probably non-functional.
Show »
Length:269
Mass (Da):29,072
Checksum:iFD9D9455379263F1
GO
Isoform b2 (identifier: Q9JJT2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MAHCMESALLLLLLLGS → MLRRAHLMDERPGQAIFLGLGSQRGS
     245-260: VSWLYALTALALQALL → ARHEWPEKSWRQKQSLFCPNAQGVLAVCTHCPGSPGPALIRNMNRGRHS

Note: Alternative N-terminal. Probably non-functional.
Show »
Length:302
Mass (Da):32,837
Checksum:iE79BEF8594400757
GO
Isoform b3 (identifier: Q9JJT2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MAHCMESALLLLLLLGS → MLRRAHLMDERPGQAIFLGLGSQRGS
     138-190: PRLLAFQASC...YLDNVSARVA → CVRAGRAGPL...RVVCASTQAS
     191-260: Missing.

Note: Alternative N-terminal. Probably non-functional.
Show »
Length:199
Mass (Da):21,266
Checksum:i2B0DD3DF16B98CEC
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0072261 – 17MAHCM…LLLGS → MLRRAHLMDERPGQAIFLGL GSQRGS in isoform b1, isoform b2 and isoform b3. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_007228138 – 190PRLLA…SARVA → CVRAGRAGPLTRVRARAGPV SLPSRPHALPRPAPATAARR RGARVVCASTQAS in isoform a3 and isoform b3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_007229191 – 260Missing in isoform a3 and isoform b3. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_007227245 – 260VSWLY…LQALL → ARHEWPEKSWRQKQSLFCPN AQGVLAVCTHCPGSPGPALI RNMNRGRHS in isoform a2 and isoform b2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ276870 mRNA Translation: CAB89690.1
AJ276871 mRNA Translation: CAB89691.1
AJ276872 mRNA Translation: CAB89692.1
AJ276514 mRNA Translation: CAB89687.1
AJ276515 mRNA Translation: CAB89688.1
AJ276516 mRNA Translation: CAB89689.1
AL833771 Genomic DNA No translation available.
CCDSiCCDS16752.1 [Q9JJT2-5]
CCDS50715.1 [Q9JJT2-2]
CCDS59637.1 [Q9JJT2-4]
CCDS59638.1 [Q9JJT2-1]
RefSeqiNP_001129535.1, NM_001136063.2 [Q9JJT2-2]
NP_001257930.1, NM_001271001.1 [Q9JJT2-1]
NP_001257931.1, NM_001271002.1 [Q9JJT2-4]
NP_064398.1, NM_020014.2 [Q9JJT2-5]
UniGeneiMm.198399

Genome annotation databases

EnsembliENSMUST00000028787; ENSMUSP00000028787; ENSMUSG00000027316 [Q9JJT2-5]
ENSMUST00000066958; ENSMUSP00000068357; ENSMUSG00000027316 [Q9JJT2-1]
ENSMUST00000110234; ENSMUSP00000105863; ENSMUSG00000027316 [Q9JJT2-6]
ENSMUST00000110235; ENSMUSP00000105864; ENSMUSG00000027316 [Q9JJT2-3]
ENSMUST00000110239; ENSMUSP00000105868; ENSMUSG00000027316 [Q9JJT2-4]
ENSMUST00000110240; ENSMUSP00000105869; ENSMUSG00000027316 [Q9JJT2-2]
GeneIDi14588
KEGGimmu:14588
UCSCiuc008mkd.2 mouse [Q9JJT2-2]
uc008mkg.2 mouse [Q9JJT2-4]
uc008mkh.2 mouse [Q9JJT2-1]
uc008mki.1 mouse [Q9JJT2-6]
uc008mkj.1 mouse [Q9JJT2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ276870 mRNA Translation: CAB89690.1
AJ276871 mRNA Translation: CAB89691.1
AJ276872 mRNA Translation: CAB89692.1
AJ276514 mRNA Translation: CAB89687.1
AJ276515 mRNA Translation: CAB89688.1
AJ276516 mRNA Translation: CAB89689.1
AL833771 Genomic DNA No translation available.
CCDSiCCDS16752.1 [Q9JJT2-5]
CCDS50715.1 [Q9JJT2-2]
CCDS59637.1 [Q9JJT2-4]
CCDS59638.1 [Q9JJT2-1]
RefSeqiNP_001129535.1, NM_001136063.2 [Q9JJT2-2]
NP_001257930.1, NM_001271001.1 [Q9JJT2-1]
NP_001257931.1, NM_001271002.1 [Q9JJT2-4]
NP_064398.1, NM_020014.2 [Q9JJT2-5]
UniGeneiMm.198399

3D structure databases

ProteinModelPortaliQ9JJT2
SMRiQ9JJT2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000028787

Proteomic databases

PaxDbiQ9JJT2
PRIDEiQ9JJT2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028787; ENSMUSP00000028787; ENSMUSG00000027316 [Q9JJT2-5]
ENSMUST00000066958; ENSMUSP00000068357; ENSMUSG00000027316 [Q9JJT2-1]
ENSMUST00000110234; ENSMUSP00000105863; ENSMUSG00000027316 [Q9JJT2-6]
ENSMUST00000110235; ENSMUSP00000105864; ENSMUSG00000027316 [Q9JJT2-3]
ENSMUST00000110239; ENSMUSP00000105868; ENSMUSG00000027316 [Q9JJT2-4]
ENSMUST00000110240; ENSMUSP00000105869; ENSMUSG00000027316 [Q9JJT2-2]
GeneIDi14588
KEGGimmu:14588
UCSCiuc008mkd.2 mouse [Q9JJT2-2]
uc008mkg.2 mouse [Q9JJT2-4]
uc008mkh.2 mouse [Q9JJT2-1]
uc008mki.1 mouse [Q9JJT2-6]
uc008mkj.1 mouse [Q9JJT2-3]

Organism-specific databases

CTDi64096
MGIiMGI:1341873 Gfra4

Phylogenomic databases

eggNOGiENOG410J23G Eukaryota
ENOG4111972 LUCA
GeneTreeiENSGT00550000074579
HOVERGENiHBG051727
InParanoidiQ9JJT2
OMAiTFVPACA
PhylomeDBiQ9JJT2
TreeFamiTF331647

Enzyme and pathway databases

ReactomeiR-MMU-5673001 RAF/MAP kinase cascade
R-MMU-8853659 RET signaling

Miscellaneous databases

PROiPR:Q9JJT2
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027316 Expressed in 52 organ(s), highest expression level in sympathetic ganglion
ExpressionAtlasiQ9JJT2 baseline and differential
GenevisibleiQ9JJT2 MM

Family and domain databases

InterProiView protein in InterPro
IPR016017 GDNF/GAS1
IPR037193 GDNF_alpha
IPR003438 GDNF_rcpt
PANTHERiPTHR10269 PTHR10269, 1 hit
PfamiView protein in Pfam
PF02351 GDNF, 2 hits
PRINTSiPR01316 GDNFRECEPTOR
SMARTiView protein in SMART
SM00907 GDNF, 2 hits
SUPFAMiSSF110035 SSF110035, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGFRA4_MOUSE
AccessioniPrimary (citable) accession number: Q9JJT2
Secondary accession number(s): A2AP44
, A2AP46, A2AP47, A2AP49, Q9JJT3, Q9JJT4, Q9JJT6, Q9JJT7, Q9JJT8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: April 23, 2003
Last modified: September 12, 2018
This is version 110 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again