Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (31 Jul 2019)
Sequence version 2 (23 Apr 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

GDNF family receptor alpha-4

Gene

Gfra4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for persephin. Mediates the GDNF-induced autophosphorylation and activation of the RET receptor. May be important in C-cell development and, in the postnatal development of the adrenal medulla.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • coreceptor activity Source: MGI
  • glial cell-derived neurotrophic factor receptor activity Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5673001 RAF/MAP kinase cascade
R-MMU-8853659 RET signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GDNF family receptor alpha-4
Short name:
GDNF receptor alpha-4
Short name:
GDNFR-alpha-4
Short name:
GFR-alpha-4
Alternative name(s):
Persephin receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Gfra4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1341873 Gfra4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001079524 – 237GDNF family receptor alpha-4Add BLAST214
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000010796238 – 260Removed in mature formSequence analysisAdd BLAST23

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi184N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi237GPI-anchor amidated threonineSequence analysis1

Keywords - PTMi

Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9JJT2

PRoteomics IDEntifications database

More...
PRIDEi
Q9JJT2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in many tissues including adrenal medulla, brain neurons, with highest levels in the cerebral cortex and hippocampus. Moderate levels found in the gut circular muscle and myenteric ganglia as well as in other peripheral ganglia, including the sensory dorsal root and trigeminal as well as superior cervical and sympathetic chain ganglia. Isoform a1, isoform a2, isoform b1 and isoform b2 are exclusively found in the thyroid, parthyroid and pituitary glands.

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in several tissues at different embryonic and postnatal stages such as the condensing mesenchyme of developing bones and developing nervous system. Expressed in the developing pituitary gland from 16 dpc and in developing thyroid C-cells from 14 dpc. In the ventral spinal cord, levels decline before birth. In the parathyroid, levels first detected in 3- to 6-week-old mice with high expression. In the adrenal medulla, expressed only in newborn, postnatal (P08) and adult mice. Isoform a1 and isoform b1 are prefentially expressed in 3-week-old thyroid, isoform a2 and isoform b2 in newborn and 6-week-old thyroid glands as well as in postnatal adrenal and pituitary glands.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000027316 Expressed in 52 organ(s), highest expression level in sympathetic ganglion

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9JJT2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9JJT2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SORL1.

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000028787

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9JJT2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GDNFR family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J23G Eukaryota
ENOG4111972 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160491

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9JJT2

Identification of Orthologs from Complete Genome Data

More...
OMAi
TFVPACA

Database of Orthologous Groups

More...
OrthoDBi
1007489at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9JJT2

TreeFam database of animal gene trees

More...
TreeFami
TF331647

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016017 GDNF/GAS1
IPR037193 GDNF_alpha
IPR003438 GDNF_rcpt

The PANTHER Classification System

More...
PANTHERi
PTHR10269 PTHR10269, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02351 GDNF, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01316 GDNFRECEPTOR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00907 GDNF, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF110035 SSF110035, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Tissue-specific and, developmentally regulated splicing.
Isoform a1 (identifier: Q9JJT2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAHCMESALL LLLLLGSASF TDGNRCVDAA EACTADERCQ QLRSEYVARC
60 70 80 90 100
LGRAAPGGRP GPGGCVRSRC RRALRRFFAR GPPALTHALL FCGCEGSACA
110 120 130 140 150
ERRRQTFAPA CAFSGPGLVP PSCLEPLERC ERSRLCRPRL LAFQASCAPA
160 170 180 190 200
PGSRDRCPEE GGPRCLRVYA GLIGTVVTPN YLDNVSARVA PWCGCAASGN
210 220 230 240 250
RREECEAFRK LFTRNPCLDG AIQAFDSLQP SVLQDQTAGC CFPRVSWLYA
260
LTALALQALL
Length:260
Mass (Da):27,990
Last modified:April 23, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2679BBC789E38075
GO
Isoform a2 (identifier: Q9JJT2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-260: VSWLYALTALALQALL → ARHEWPEKSWRQKQSLFCPNAQGVLAVCTHCPGSPGPALIRNMNRGRHS

Show »
Length:293
Mass (Da):31,755
Checksum:i4A515A4D590328F3
GO
Isoform a3 (identifier: Q9JJT2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     138-190: PRLLAFQASC...YLDNVSARVA → CVRAGRAGPL...RVVCASTQAS
     191-260: Missing.

Show »
Length:190
Mass (Da):20,183
Checksum:iDB36AB0C6FB88618
GO
Isoform b1 (identifier: Q9JJT2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MAHCMESALLLLLLLGS → MLRRAHLMDERPGQAIFLGLGSQRGS

Note: Alternative N-terminal. Probably non-functional.
Show »
Length:269
Mass (Da):29,072
Checksum:iFD9D9455379263F1
GO
Isoform b2 (identifier: Q9JJT2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MAHCMESALLLLLLLGS → MLRRAHLMDERPGQAIFLGLGSQRGS
     245-260: VSWLYALTALALQALL → ARHEWPEKSWRQKQSLFCPNAQGVLAVCTHCPGSPGPALIRNMNRGRHS

Note: Alternative N-terminal. Probably non-functional.
Show »
Length:302
Mass (Da):32,837
Checksum:iE79BEF8594400757
GO
Isoform b3 (identifier: Q9JJT2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MAHCMESALLLLLLLGS → MLRRAHLMDERPGQAIFLGLGSQRGS
     138-190: PRLLAFQASC...YLDNVSARVA → CVRAGRAGPL...RVVCASTQAS
     191-260: Missing.

Note: Alternative N-terminal. Probably non-functional.
Show »
Length:199
Mass (Da):21,266
Checksum:i2B0DD3DF16B98CEC
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0072261 – 17MAHCM…LLLGS → MLRRAHLMDERPGQAIFLGL GSQRGS in isoform b1, isoform b2 and isoform b3. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_007228138 – 190PRLLA…SARVA → CVRAGRAGPLTRVRARAGPV SLPSRPHALPRPAPATAARR RGARVVCASTQAS in isoform a3 and isoform b3. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_007229191 – 260Missing in isoform a3 and isoform b3. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_007227245 – 260VSWLY…LQALL → ARHEWPEKSWRQKQSLFCPN AQGVLAVCTHCPGSPGPALI RNMNRGRHS in isoform a2 and isoform b2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ276870 mRNA Translation: CAB89690.1
AJ276871 mRNA Translation: CAB89691.1
AJ276872 mRNA Translation: CAB89692.1
AJ276514 mRNA Translation: CAB89687.1
AJ276515 mRNA Translation: CAB89688.1
AJ276516 mRNA Translation: CAB89689.1
AL833771 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16752.1 [Q9JJT2-5]
CCDS50715.1 [Q9JJT2-2]
CCDS59637.1 [Q9JJT2-4]
CCDS59638.1 [Q9JJT2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129535.1, NM_001136063.2 [Q9JJT2-2]
NP_001257930.1, NM_001271001.1 [Q9JJT2-1]
NP_001257931.1, NM_001271002.1 [Q9JJT2-4]
NP_064398.1, NM_020014.2 [Q9JJT2-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000028787; ENSMUSP00000028787; ENSMUSG00000027316 [Q9JJT2-5]
ENSMUST00000066958; ENSMUSP00000068357; ENSMUSG00000027316 [Q9JJT2-1]
ENSMUST00000110234; ENSMUSP00000105863; ENSMUSG00000027316 [Q9JJT2-6]
ENSMUST00000110235; ENSMUSP00000105864; ENSMUSG00000027316 [Q9JJT2-3]
ENSMUST00000110239; ENSMUSP00000105868; ENSMUSG00000027316 [Q9JJT2-4]
ENSMUST00000110240; ENSMUSP00000105869; ENSMUSG00000027316 [Q9JJT2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
14588

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:14588

UCSC genome browser

More...
UCSCi
uc008mkd.2 mouse [Q9JJT2-2]
uc008mkg.2 mouse [Q9JJT2-4]
uc008mkh.2 mouse [Q9JJT2-1]
uc008mki.1 mouse [Q9JJT2-6]
uc008mkj.1 mouse [Q9JJT2-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ276870 mRNA Translation: CAB89690.1
AJ276871 mRNA Translation: CAB89691.1
AJ276872 mRNA Translation: CAB89692.1
AJ276514 mRNA Translation: CAB89687.1
AJ276515 mRNA Translation: CAB89688.1
AJ276516 mRNA Translation: CAB89689.1
AL833771 Genomic DNA No translation available.
CCDSiCCDS16752.1 [Q9JJT2-5]
CCDS50715.1 [Q9JJT2-2]
CCDS59637.1 [Q9JJT2-4]
CCDS59638.1 [Q9JJT2-1]
RefSeqiNP_001129535.1, NM_001136063.2 [Q9JJT2-2]
NP_001257930.1, NM_001271001.1 [Q9JJT2-1]
NP_001257931.1, NM_001271002.1 [Q9JJT2-4]
NP_064398.1, NM_020014.2 [Q9JJT2-5]

3D structure databases

SMRiQ9JJT2
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000028787

Proteomic databases

PaxDbiQ9JJT2
PRIDEiQ9JJT2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028787; ENSMUSP00000028787; ENSMUSG00000027316 [Q9JJT2-5]
ENSMUST00000066958; ENSMUSP00000068357; ENSMUSG00000027316 [Q9JJT2-1]
ENSMUST00000110234; ENSMUSP00000105863; ENSMUSG00000027316 [Q9JJT2-6]
ENSMUST00000110235; ENSMUSP00000105864; ENSMUSG00000027316 [Q9JJT2-3]
ENSMUST00000110239; ENSMUSP00000105868; ENSMUSG00000027316 [Q9JJT2-4]
ENSMUST00000110240; ENSMUSP00000105869; ENSMUSG00000027316 [Q9JJT2-2]
GeneIDi14588
KEGGimmu:14588
UCSCiuc008mkd.2 mouse [Q9JJT2-2]
uc008mkg.2 mouse [Q9JJT2-4]
uc008mkh.2 mouse [Q9JJT2-1]
uc008mki.1 mouse [Q9JJT2-6]
uc008mkj.1 mouse [Q9JJT2-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64096
MGIiMGI:1341873 Gfra4

Phylogenomic databases

eggNOGiENOG410J23G Eukaryota
ENOG4111972 LUCA
GeneTreeiENSGT00940000160491
InParanoidiQ9JJT2
OMAiTFVPACA
OrthoDBi1007489at2759
PhylomeDBiQ9JJT2
TreeFamiTF331647

Enzyme and pathway databases

ReactomeiR-MMU-5673001 RAF/MAP kinase cascade
R-MMU-8853659 RET signaling

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9JJT2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000027316 Expressed in 52 organ(s), highest expression level in sympathetic ganglion
ExpressionAtlasiQ9JJT2 baseline and differential
GenevisibleiQ9JJT2 MM

Family and domain databases

InterProiView protein in InterPro
IPR016017 GDNF/GAS1
IPR037193 GDNF_alpha
IPR003438 GDNF_rcpt
PANTHERiPTHR10269 PTHR10269, 1 hit
PfamiView protein in Pfam
PF02351 GDNF, 2 hits
PRINTSiPR01316 GDNFRECEPTOR
SMARTiView protein in SMART
SM00907 GDNF, 2 hits
SUPFAMiSSF110035 SSF110035, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGFRA4_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JJT2
Secondary accession number(s): A2AP44
, A2AP46, A2AP47, A2AP49, Q9JJT3, Q9JJT4, Q9JJT6, Q9JJT7, Q9JJT8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: April 23, 2003
Last modified: July 31, 2019
This is version 116 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again