Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9JJP2 (P73_MOUSE)

Protein

Tumor protein p73

Gene

Tp73

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein.By similarity2 Publications

Miscellaneous

Activated and stabilized by interaction with RANBP9.By similarity

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi186ZincBy similarity1
Metal bindingi189ZincBy similarity1
Metal bindingi250ZincBy similarity1
Metal bindingi254ZincBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processApoptosis, Cell cycle, Transcription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-6804759 Regulation of TP53 Activity through Association with Co-factors
R-MMU-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor protein p73By similarity
Alternative name(s):
p53-like transcription factorBy similarity
p53-related proteinBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tp73
Synonyms:P73Imported, Trp73Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1336991 Trp73

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice lacking Tp73 display a runting phenotype and high rates of mortality due to massive gastrointestinal hemorrhages or intracranial bleeding. The gastrointestinal tract suffers loss of enterocytes and excessive mucosecretions in the duodenum, ileum and cecum. Survivors exhibit hippocampal dysgenesis, hydrocephalus, chronic infections and inflammation, as well as abnormalities in pheromone sensory pathways.1 Publication

Keywords - Diseasei

Tumor suppressor

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003702111 – 631Tumor protein p73Add BLAST631

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei24Phosphothreonine; by PLK1By similarity1
Modified residuei25Phosphotyrosine; by SRC and HCKBy similarity1
Modified residuei91Phosphotyrosine; by ABL1By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki622Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternateBy similarity
Cross-linki622Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylated on Lys-622, which potentiates proteasomal degradation but does not affect transcriptional activity.By similarity
Phosphorylation by PLK1 and PLK3 inhibits the transcription regulator activity and pro-apoptotic function (By similarity). Higher levels of phosphorylation seen in striatal neurons of. mutant huntingtin (htt) transgenic mice.By similarity1 Publication
Polyubiquitinated by RCHY1/PIRH2; leading to its degradation by the proteasome.By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9JJP2

PRoteomics IDEntifications database

More...PRIDEi		Q9JJP2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9JJP2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9JJP2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found in striatal neurons of mutant huntingtin (htt) transgenic mice (at protein level). Isoform 1 is expressed in the nasal epithelium, the vomeronasal organ, the hippocampus and the hypothalamus.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000029026 Expressed in 66 organ(s), highest expression level in cerebral cortex

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9JJP2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9JJP2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a complex with p53/TP53 and CABLES1. The C-terminal oligomerization domain binds to the ABL1 tyrosine kinase SH3 domain. Interacts with HECW2, HIPK2, RANBP9 and WWOX (By similarity). Interacts (via SAM domain) with FBXO45 (via B30.2/SPRY domain) (By similarity). Interacts with YAP1 (phosphorylated form) (By similarity). Interacts with HCK (via SH3 domain); this inhibits TP73 activity and degradation (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Yap1P469382EBI-1770138,EBI-1211949

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		204326, 5 interactors

Database of interacting proteins

More...DIPi		DIP-41942N

Protein interaction database and analysis system

More...IntActi		Q9JJP2, 3 interactors

Molecular INTeraction database

More...MINTi		Q9JJP2

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000101269

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q9JJP2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9JJP2

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini479 – 545SAMSequence analysisAdd BLAST67

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 43TransactivationBy similarityAdd BLAST43
Regioni123 – 302DNA-bindingBy similarityAdd BLAST180
Regioni337 – 378OligomerizationSequence analysisAdd BLAST42
Regioni337 – 372Interaction with HIPK2By similarityAdd BLAST36

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi477 – 481PPxY motifBy similarity5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi5 – 10Poly-SerSequence analysis6
Compositional biasi383 – 388Poly-GlnSequence analysis6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Possesses an acidic transactivation domain, a central DNA binding domain and a C-terminal oligomerization domain that binds to the ABL1 tyrosine kinase SH3 domain.By similarity
The PPxY motif mediates interaction with WWOX.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the p53 family.By similarity

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IGE4 Eukaryota
ENOG410XV9W LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154023

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9JJP2

KEGG Orthology (KO)

More...KOi		K10148

Identification of Orthologs from Complete Genome Data

More...OMAi		IWRGLQE

Database of Orthologous Groups

More...OrthoDBi		257530at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9JJP2

TreeFam database of animal gene trees

More...TreeFami		TF106101

Family and domain databases

Conserved Domains Database

More...CDDi		cd08367 P53, 1 hit
cd09571 SAM_tumor-p73, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.720, 1 hit
4.10.170.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008967 p53-like_TF_DNA-bd
IPR012346 p53/RUNT-type_TF_DNA-bd_sf
IPR011615 p53_DNA-bd
IPR036674 p53_tetramer_sf
IPR010991 p53_tetrameristn
IPR002117 p53_tumour_suppressor
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR032646 Tp73
IPR037612 Tumour-p73_SAM

The PANTHER Classification System

More...PANTHERi		PTHR11447 PTHR11447, 1 hit
PTHR11447:SF21 PTHR11447:SF21, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00870 P53, 1 hit
PF07710 P53_tetramer, 1 hit
PF07647 SAM_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00386 P53SUPPRESSR

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00454 SAM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47719 SSF47719, 1 hit
SSF47769 SSF47769, 1 hit
SSF49417 SSF49417, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00348 P53, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9JJP2-1) [UniParc]FASTAAdd to basket
Also known as: AlphaBy similarity

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQTSSSSSS TFEHLWSSLE PDSTYFDLPQ PSQGTSEASG SEESNMDVFH 
        60         70         80         90        100
LQGMAQFNLL SSAMDQMGSR AAPASPYTPE HAASAPTHSP YAQPSSTFDT 
       110        120        130        140        150
MSPAPVIPSN TDYPGPHHFE VTFQQSSTAK SATWTYSPLL KKLYCQIAKT 
       160        170        180        190        200
CPIQIKVSTP PPPGTAIRAM PVYKKAEHVT DIVKRCPNHE LGRDFNEGQS 
       210        220        230        240        250
APASHLIRVE GNNLAQYVDD PVTGRQSVVV PYEPPQVGTE FTTILYNFMC 
       260        270        280        290        300
NSSCVGGMNR RPILVIITLE TRDGQVLGRR SFEGRICACP GRDRKADEDH 
       310        320        330        340        350
YREQQALNES TTKNGAASKR AFKQSPPAIP ALGTNVKKRR HGDEDMFYMH 
       360        370        380        390        400
VRGRENFEIL MKVKESLELM ELVPQPLVDS YRQQQQQQLL QRPSHLQPPS 
       410        420        430        440        450
YGPVLSPMNK VHGGVNKLPS VNQLVGQPPP HSSAAGPNLG PMGSGMLNSH 
       460        470        480        490        500
GHSMPANGEM NGGHSSQTMV SGSHCTPPPP YHADPSLVSF LTGLGCPNCI 
       510        520        530        540        550
ECFTSQGLQS IYHLQNLTIE DLGALKVPDQ YRMTIWRGLQ DLKQSHDCGQ 
       560        570        580        590        600
QLLRSSSNAA TISIGGSGEL QRQRVMEAVH FRVRHTITIP NRGGAGAVTG 
       610        620        630 
PDEWADFGFD LPDCKSRKQP IKEEFTETES H
Length:631
Mass (Da):69,096
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE364D566A90CBF1D
GO
Isoform 22 Publications (identifier: Q9JJP2-2) [UniParc]FASTAAdd to basket
Also known as: dN-AlphaBy similarity

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT

Note: Produced by alternative promoter usage.Curated1 Publication
Show »
Length:590
Mass (Da):64,725
Checksum:i8580C7EFA21B5797
GO
Isoform 3 (identifier: Q9JJP2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT
     489-493: SFLTG → RTLGL
     494-631: Missing.

Note: Produced by alternative splicing of isoform 2. No experimental confirmation available.Curated1 Publication
Show »
Length:452
Mass (Da):49,392
Checksum:i13C8757F5A4A5FFC
GO
Isoform 41 Publication (identifier: Q9JJP2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MAQTSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQGM → MLYVGDPMRHLAT
     394-489: Missing.

Note: Produced by alternative splicing of isoform 2. No experimental confirmation available.Curated1 Publication
Show »
Length:494
Mass (Da):55,025
Checksum:iFA7D89986822E491
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Z4YK94Z4YK94_MOUSE
Tumor protein p73
Trp73
638Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3UYS2G3UYS2_MOUSE
Cellular tumor antigen p53
Trp73
367Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BK76H3BK76_MOUSE
Cellular tumor antigen p53
Trp73
213Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AX91B1AX91_MOUSE
Transformation-related protein 73
Trp73
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAM18775 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti118H → D in BAB30732 (PubMed:16141072).Curated1
Sequence conflicti127S → G in BAE24089 (PubMed:16141072).Curated1
Sequence conflicti254C → S in AAD32213 (PubMed:15489334).Curated1
Sequence conflicti352 – 353RG → SAS in AAD32213 (PubMed:15489334).Curated2
Sequence conflicti376P → H in AAD32213 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0530811 – 54MAQTS…HLQGM → MLYVGDPMRHLAT in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST54
Alternative sequenceiVSP_053082394 – 489Missing in isoform 4. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_053083489 – 493SFLTG → RTLGL in isoform 3. Curated5
Alternative sequenceiVSP_053084494 – 631Missing in isoform 3. CuratedAdd BLAST138

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y19234 mRNA Translation: CAB81953.1
Y19235 mRNA Translation: CAB81954.1
AK017412 mRNA Translation: BAB30732.1
AK139633 mRNA Translation: BAE24089.1
AL806525 Genomic DNA Translation: CAM18773.1
AL806525 Genomic DNA Translation: CAM18774.1
AL806525 Genomic DNA Translation: CAM18775.1 Different initiation.
CH466594 Genomic DNA Translation: EDL14957.1
BC066045 mRNA Translation: AAH66045.1
AF138873 Genomic DNA Translation: AAD32213.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS51396.1 [Q9JJP2-4]
CCDS51397.1 [Q9JJP2-2]

NCBI Reference Sequences

More...RefSeqi		NP_001119802.1, NM_001126330.1 [Q9JJP2-2]
NP_001119803.1, NM_001126331.1 [Q9JJP2-4]
NP_035772.2, NM_011642.3

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Mm.78015

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000097762; ENSMUSP00000095368; ENSMUSG00000029026 [Q9JJP2-4]
ENSMUST00000105643; ENSMUSP00000101268; ENSMUSG00000029026 [Q9JJP2-3]
ENSMUST00000133533; ENSMUSP00000114418; ENSMUSG00000029026 [Q9JJP2-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		22062

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:22062

UCSC genome browser

More...UCSCi		uc008wbg.2 mouse [Q9JJP2-2]
uc012dqi.1 mouse [Q9JJP2-4]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y19234 mRNA Translation: CAB81953.1
Y19235 mRNA Translation: CAB81954.1
AK017412 mRNA Translation: BAB30732.1
AK139633 mRNA Translation: BAE24089.1
AL806525 Genomic DNA Translation: CAM18773.1
AL806525 Genomic DNA Translation: CAM18774.1
AL806525 Genomic DNA Translation: CAM18775.1 Different initiation.
CH466594 Genomic DNA Translation: EDL14957.1
BC066045 mRNA Translation: AAH66045.1
AF138873 Genomic DNA Translation: AAD32213.1
CCDSiCCDS51396.1 [Q9JJP2-4]
CCDS51397.1 [Q9JJP2-2]
RefSeqiNP_001119802.1, NM_001126330.1 [Q9JJP2-2]
NP_001119803.1, NM_001126331.1 [Q9JJP2-4]
NP_035772.2, NM_011642.3
UniGeneiMm.78015

3D structure databases

ProteinModelPortaliQ9JJP2
SMRiQ9JJP2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204326, 5 interactors
DIPiDIP-41942N
IntActiQ9JJP2, 3 interactors
MINTiQ9JJP2
STRINGi10090.ENSMUSP00000101269

PTM databases

iPTMnetiQ9JJP2
PhosphoSitePlusiQ9JJP2

Proteomic databases

PaxDbiQ9JJP2
PRIDEiQ9JJP2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000097762; ENSMUSP00000095368; ENSMUSG00000029026 [Q9JJP2-4]
ENSMUST00000105643; ENSMUSP00000101268; ENSMUSG00000029026 [Q9JJP2-3]
ENSMUST00000133533; ENSMUSP00000114418; ENSMUSG00000029026 [Q9JJP2-2]
GeneIDi22062
KEGGimmu:22062
UCSCiuc008wbg.2 mouse [Q9JJP2-2]
uc012dqi.1 mouse [Q9JJP2-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		22062
MGIiMGI:1336991 Trp73

Phylogenomic databases

eggNOGiENOG410IGE4 Eukaryota
ENOG410XV9W LUCA
GeneTreeiENSGT00940000154023
InParanoidiQ9JJP2
KOiK10148
OMAiIWRGLQE
OrthoDBi257530at2759
PhylomeDBiQ9JJP2
TreeFamiTF106101

Enzyme and pathway databases

ReactomeiR-MMU-6804759 Regulation of TP53 Activity through Association with Co-factors
R-MMU-8939236 RUNX1 regulates transcription of genes involved in differentiation of HSCs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Trp73 mouse

Protein Ontology

More...PROi		PR:Q9JJP2

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000029026 Expressed in 66 organ(s), highest expression level in cerebral cortex
ExpressionAtlasiQ9JJP2 baseline and differential
GenevisibleiQ9JJP2 MM

Family and domain databases

CDDicd08367 P53, 1 hit
cd09571 SAM_tumor-p73, 1 hit
Gene3Di2.60.40.720, 1 hit
4.10.170.10, 1 hit
InterProiView protein in InterPro
IPR008967 p53-like_TF_DNA-bd
IPR012346 p53/RUNT-type_TF_DNA-bd_sf
IPR011615 p53_DNA-bd
IPR036674 p53_tetramer_sf
IPR010991 p53_tetrameristn
IPR002117 p53_tumour_suppressor
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR032646 Tp73
IPR037612 Tumour-p73_SAM
PANTHERiPTHR11447 PTHR11447, 1 hit
PTHR11447:SF21 PTHR11447:SF21, 1 hit
PfamiView protein in Pfam
PF00870 P53, 1 hit
PF07710 P53_tetramer, 1 hit
PF07647 SAM_2, 1 hit
PRINTSiPR00386 P53SUPPRESSR
SMARTiView protein in SMART
SM00454 SAM, 1 hit
SUPFAMiSSF47719 SSF47719, 1 hit
SSF47769 SSF47769, 1 hit
SSF49417 SSF49417, 1 hit
PROSITEiView protein in PROSITE
PS00348 P53, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiP73_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JJP2
Secondary accession number(s): B1AX89
, B1AX90, Q3UT91, Q9CU77, Q9JJP1, Q9WUJ0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 14, 2009
Last sequence update: October 1, 2000
Last modified: January 16, 2019
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again