Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (22 Apr 2020)
Sequence version 3 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Apoptotic chromatin condensation inducer in the nucleus

Gene

Acin1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Component of the ASAP complexes which bind RNA in a sequence-independent manner and are proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets; ACIN1 confers RNA-binding to the complex. The ASAP complex can inhibit RNA processing during in vitro splicing reactions. The ASAP complex promotes apoptosis and is disassembled after induction of apoptosis. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms such as Bcl-X(S); the activity is different from the established EJC assembly and function. Induces apoptotic chromatin condensation after activation by CASP3. Regulates cyclin A1, but not cyclin A2, expression in leukemia cells (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, mRNA processing, mRNA splicing

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-111465 Apoptotic cleavage of cellular proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Apoptotic chromatin condensation inducer in the nucleus
Short name:
Acinus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Acin1
Synonyms:Acinus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1891824 Acin1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000644371 – 1338Apoptotic chromatin condensation inducer in the nucleusAdd BLAST1338

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei132PhosphoserineBy similarity1
Modified residuei166PhosphoserineBy similarity1
Modified residuei169PhosphoserineBy similarity1
Modified residuei208PhosphoserineBy similarity1
Modified residuei210PhosphoserineBy similarity1
Modified residuei216PhosphoserineCombined sources1
Modified residuei242PhosphoserineBy similarity1
Modified residuei253PhosphothreonineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki267Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity
Modified residuei295PhosphoserineCombined sources1
Cross-linki318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei332PhosphoserineBy similarity1
Modified residuei369PhosphoserineBy similarity1
Cross-linki378Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei387PhosphoserineCombined sources1
Modified residuei389PhosphoserineCombined sources1
Modified residuei391PhosphoserineCombined sources1
Modified residuei413PhosphoserineCombined sources1
Modified residuei417PhosphothreonineCombined sources1
Modified residuei423PhosphothreonineBy similarity1
Modified residuei454PhosphoserineCombined sources1
Modified residuei477PhosphoserineCombined sources1
Modified residuei479PhosphoserineCombined sources1
Modified residuei491PhosphoserineCombined sources1
Modified residuei497PhosphoserineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei654N6,N6,N6-trimethyllysine; by EHMT2; alternateBy similarity1
Modified residuei654N6,N6-dimethyllysine; by EHMT2; alternateBy similarity1
Modified residuei655PhosphoserineBy similarity1
Modified residuei657PhosphoserineBy similarity1
Modified residuei710PhosphoserineCombined sources1
Modified residuei729PhosphoserineBy similarity1
Cross-linki732Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei825PhosphoserineBy similarity1
Modified residuei838PhosphoserineCombined sources1
Modified residuei861N6-acetyllysine; alternateCombined sources1
Cross-linki861Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Cross-linki879Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei895PhosphoserineBy similarity1
Modified residuei898PhosphoserineCombined sources1
Cross-linki969Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei975PhosphothreonineBy similarity1
Modified residuei986PhosphoserineCombined sources1
Modified residuei989PhosphoserineBy similarity1
Modified residuei1003PhosphoserineCombined sources1
Cross-linki1046Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1106Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1179Phosphoserine; by SRPK2 and PKB/AKT1By similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Undergoes proteolytic cleavage; the processed form is active, contrary to the uncleaved form.By similarity
Phosphorylation on Ser-1179 by SRPK2 up-regulates its stimulatory effect on cyclin A1.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei1093 – 1094Cleavage; by caspase-3By similarity2

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
non-CPTAC-3629

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9JIX8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9JIX8

PeptideAtlas

More...
PeptideAtlasi
Q9JIX8

PRoteomics IDEntifications database

More...
PRIDEi
Q9JIX8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9JIX8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9JIX8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022185 Expressed in female gonad and 273 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9JIX8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9JIX8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a mRNA splicing-dependent exon junction complex (EJC).

Component of the heterotrimeric ASAP (apoptosis- and splicing-associated protein) complexes consisting of RNPS1, SAP18 and different isoforms of ACIN1; the association of SAP18 seems to require a preformed RNPS1:ACIN1 complex.

Interacts with API5.

Interacts with SRPK2 in a phosphorylation-dependent manner (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
207849, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q9JIX8, 9 interactors

Molecular INTeraction database

More...
MINTi
Q9JIX8

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000022793

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9JIX8 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9JIX8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini72 – 106SAPPROSITE-ProRule annotationAdd BLAST35

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1209 – 1236Sufficient for interaction with RNPS1 and SAP18 and formation of th ASAP complexBy similarityAdd BLAST28

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi142 – 443Glu-richAdd BLAST302
Compositional biasi569 – 667Ser-richAdd BLAST99
Compositional biasi1113 – 1130Pro-richAdd BLAST18
Compositional biasi1131 – 1338Arg/Asp/Glu/Lys-richAdd BLAST208

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2416 Eukaryota
ENOG4111HR1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00710000106790

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_482284_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9JIX8

KEGG Orthology (KO)

More...
KOi
K12875

TreeFam database of animal gene trees

More...
TreeFami
TF320727

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12432 RRM_ACINU, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.720.30, 1 hit
3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR034257 Acinus_RRM
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR032552 RSB_motif
IPR003034 SAP_dom
IPR036361 SAP_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16294 RSB_motif, 1 hit
PF02037 SAP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00513 SAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 1 hit
SSF68906 SSF68906, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50800 SAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9JIX8-1) [UniParc]FASTAAdd to basket
Also known as: L

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWGRKRPNSS GETRGILSGN RGVDYGSGRG QSGPFEGRWR KLPKMPEAVG
60 70 80 90 100
TDPSTSRKMA ELEEVTLDGK PLQALRVTDL KAALEQRGLA KSGQKSALVK
110 120 130 140 150
RLKGALMLEN LQKHSTPHAA FQPNSQIGEE MSQNSFIKQY LEKQQELLRQ
160 170 180 190 200
RLEREAREAA ELEEASAESE DEMTHPEGVA SLLPPDFQSS LNRPELELST
210 220 230 240 250
HSPRKSSSFS EEKGESDDEK PRKGERRSSR VRQAKSKLPE YSQTAEEEED
260 270 280 290 300
QETPSRNLRV RADRNLKIEE EEEEEEEEED DDDEEEEEVD EAQKSREAEA
310 320 330 340 350
PTLKQFEDEE GEERTRAKPE KVVDEKPLNI RSQEKGELEK GGRVTRSQEE
360 370 380 390 400
ARRSHLARQQ QEKETQIVSL PQEENEVKSS QSLEEKSQSP SPPPLPEDLE
410 420 430 440 450
KAPVVLQPEQ IVSEEETPPP LLTKEASSPP THIQLQEEME PVEGPAPPVL
460 470 480 490 500
IQLSPPNTDA GAREPLASPH PAQLLRSLSP LSGTTDTKAE SPAGRVSDES
510 520 530 540 550
VLPLAQKSSL PECSTQKGVE SEREKSAPLP LTVEEFAPAK GITEEPMKKQ
560 570 580 590 600
SLEQKEGRRA SHALFPEHSG KQSADSSSSR SSSPSSSSSP SRSPSPDSVA
610 620 630 640 650
SRPQSSPGSK QRDGAQARVH ANPHERPKMG SRSTSESRSR SRSRSRSASS
660 670 680 690 700
SSRKSLSPGV SRDSNTSYTE TKDPSCGQEA AAPSGPQLQV LEPKEKAPTF
710 720 730 740 750
SASVRGRHLS HPEPEQQHVI QRLQPEQGSP KKCEAEEAEP PAATQPQTSE
760 770 780 790 800
TQISHLLESE RTHHTVEEKE EVTMDTSENR PENEVPEPPL PVADQVSNDE
810 820 830 840 850
RPEGGAEEEE KKESSMPKSF KRKISVVSAT KGVQAGNSDT EGGQPGRKRR
860 870 880 890 900
WGASTAATQK KPSISITTES LKSLIPDIKP LAGQEAVVDL HADDSRISED
910 920 930 940 950
ETERNGDDGT HDKGLKICRT VTQVVPAEGQ ENGQREEEEE KEPEAELPAP
960 970 980 990 1000
PQVSVEVALP PPVEHEVKKV TLGDTLTRRS ISQQKSGVSI TIDDPVRTAQ
1010 1020 1030 1040 1050
VPSPPRGKIS NIVHISNLVR PFTLGQLKEL LGRTGTLVEE AFWIDKIKSH
1060 1070 1080 1090 1100
CFVTYSTVEE AVATRTALHG VKWPQSNPKF LCADYAEQDE LDYHRGLLVD
1110 1120 1130 1140 1150
RPSETKAEEQ GAPRPLHPPP PPPVQPPPHP RAEQREQERA VREQWAERER
1160 1170 1180 1190 1200
EMERRERTRS EREWDRDKVR EGPRSRSRSR DRRRKERAKS KEKKSEKKEK
1210 1220 1230 1240 1250
AQEEPPAKLL DDLFRKTKAA PCIYWLPLTE SQIVQKEAEQ AERAKEREKR
1260 1270 1280 1290 1300
RKEREEEEQK EREKEAERER NRQLEREKRR EHSRERERDR ERERDRGDRE
1310 1320 1330
RERERDRDRG RERDRRDTKR HSRSRSRSTP VRDRGGRR
Length:1,338
Mass (Da):150,719
Last modified:July 27, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i683E56058723C9D8
GO
Isoform 2 (identifier: Q9JIX8-2) [UniParc]FASTAAdd to basket
Also known as: S

The sequence of this isoform differs from the canonical sequence as follows:
     1-757: Missing.
     758-766: ESERTHHTV → MMFSDSRAG

Show »
Length:581
Mass (Da):67,185
Checksum:i38C74E0629009255
GO
Isoform 3 (identifier: Q9JIX8-3) [UniParc]FASTAAdd to basket
Also known as: S'

The sequence of this isoform differs from the canonical sequence as follows:
     1-773: Missing.

Show »
Length:565
Mass (Da):65,357
Checksum:iA68FF1692E30B303
GO
Isoform 4 (identifier: Q9JIX8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     164-204: EASAESEDEMTHPEGVASLLPPDFQSSLNRPELELSTHSPR → G

Show »
Length:1,298
Mass (Da):146,302
Checksum:iFFEC0D9BF7838055
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8JJ91B8JJ91_MOUSE
Apoptotic chromatin condensation in...
Acin1
634Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6RJ39F6RJ39_MOUSE
Apoptotic chromatin condensation in...
Acin1
1,272Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q52KR6Q52KR6_MOUSE
Acin1 protein
Acin1
552Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B8JJ92B8JJ92_MOUSE
Apoptotic chromatin condensation in...
Acin1
580Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6Q8C0F6Q8C0_MOUSE
Apoptotic chromatin condensation in...
Acin1
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B8JJ89B8JJ89_MOUSE
Apoptotic chromatin condensation in...
Acin1
256Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B8JJ90B8JJ90_MOUSE
Apoptotic chromatin condensation in...
Acin1
221Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF89661 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti244T → A in AAF89661 (Ref. 2) Curated1
Sequence conflicti515T → A in AAF89661 (Ref. 2) Curated1
Sequence conflicti536F → L in AAF89661 (Ref. 2) Curated1
Sequence conflicti557G → D in AAF89661 (Ref. 2) Curated1
Sequence conflicti568H → Y in AAF89661 (Ref. 2) Curated1
Sequence conflicti599V → A in AAF89661 (Ref. 2) Curated1
Sequence conflicti729S → I in AAF89661 (Ref. 2) Curated1
Sequence conflicti757L → P in AAF89661 (Ref. 2) Curated1
Sequence conflicti773T → A in AAD56723 (PubMed:10490026).Curated1
Sequence conflicti829Missing in BAB28030 (PubMed:16141072).Curated1
Sequence conflicti896R → Q in AAD56723 (PubMed:10490026).Curated1
Sequence conflicti896R → Q in AAD56727 (PubMed:10490026).Curated1
Sequence conflicti896R → Q in AAF89661 (Ref. 2) Curated1
Sequence conflicti1035G → R in BAB28030 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0040311 – 773Missing in isoform 3. 1 PublicationAdd BLAST773
Alternative sequenceiVSP_0040301 – 757Missing in isoform 2. 2 PublicationsAdd BLAST757
Alternative sequenceiVSP_004032164 – 204EASAE…THSPR → G in isoform 4. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_004033758 – 766ESERTHHTV → MMFSDSRAG in isoform 2. 2 Publications9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF124725 mRNA Translation: AAD56723.1
AF124729 mRNA Translation: AAD56727.1
AF168782 mRNA Translation: AAF89661.1 Frameshift.
CT009512 Genomic DNA No translation available.
AK011698 mRNA No translation available.
AK012099 mRNA Translation: BAB28030.1
AK012337 mRNA Translation: BAB28171.3
AK050467 mRNA Translation: BAC34272.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS27097.1 [Q9JIX8-1]
CCDS49492.1 [Q9JIX8-2]
CCDS56957.1 [Q9JIX8-3]
CCDS88664.1 [Q9JIX8-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001078942.2, NM_001085473.2
NP_001229534.1, NM_001242605.1 [Q9JIX8-3]
NP_062513.3, NM_019567.3
NP_075679.2, NM_023190.3 [Q9JIX8-1]
XP_006519361.1, XM_006519298.3
XP_006519367.1, XM_006519304.3 [Q9JIX8-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000022793; ENSMUSP00000022793; ENSMUSG00000022185 [Q9JIX8-1]
ENSMUST00000111484; ENSMUSP00000107109; ENSMUSG00000022185 [Q9JIX8-4]
ENSMUST00000126166; ENSMUSP00000114546; ENSMUSG00000022185 [Q9JIX8-3]
ENSMUST00000148754; ENSMUSP00000122003; ENSMUSG00000022185 [Q9JIX8-2]
ENSMUST00000167015; ENSMUSP00000125776; ENSMUSG00000022185 [Q9JIX8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56215

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:56215

UCSC genome browser

More...
UCSCi
uc007twr.2 mouse [Q9JIX8-3]
uc007twv.2 mouse [Q9JIX8-1]
uc007twx.2 mouse [Q9JIX8-4]
uc011zld.1 mouse [Q9JIX8-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124725 mRNA Translation: AAD56723.1
AF124729 mRNA Translation: AAD56727.1
AF168782 mRNA Translation: AAF89661.1 Frameshift.
CT009512 Genomic DNA No translation available.
AK011698 mRNA No translation available.
AK012099 mRNA Translation: BAB28030.1
AK012337 mRNA Translation: BAB28171.3
AK050467 mRNA Translation: BAC34272.1
CCDSiCCDS27097.1 [Q9JIX8-1]
CCDS49492.1 [Q9JIX8-2]
CCDS56957.1 [Q9JIX8-3]
CCDS88664.1 [Q9JIX8-4]
RefSeqiNP_001078942.2, NM_001085473.2
NP_001229534.1, NM_001242605.1 [Q9JIX8-3]
NP_062513.3, NM_019567.3
NP_075679.2, NM_023190.3 [Q9JIX8-1]
XP_006519361.1, XM_006519298.3
XP_006519367.1, XM_006519304.3 [Q9JIX8-3]

3D structure databases

SMRiQ9JIX8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi207849, 5 interactors
IntActiQ9JIX8, 9 interactors
MINTiQ9JIX8
STRINGi10090.ENSMUSP00000022793

PTM databases

iPTMnetiQ9JIX8
PhosphoSitePlusiQ9JIX8

Proteomic databases

CPTACinon-CPTAC-3629
jPOSTiQ9JIX8
PaxDbiQ9JIX8
PeptideAtlasiQ9JIX8
PRIDEiQ9JIX8

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
63 501 antibodies

Genome annotation databases

EnsembliENSMUST00000022793; ENSMUSP00000022793; ENSMUSG00000022185 [Q9JIX8-1]
ENSMUST00000111484; ENSMUSP00000107109; ENSMUSG00000022185 [Q9JIX8-4]
ENSMUST00000126166; ENSMUSP00000114546; ENSMUSG00000022185 [Q9JIX8-3]
ENSMUST00000148754; ENSMUSP00000122003; ENSMUSG00000022185 [Q9JIX8-2]
ENSMUST00000167015; ENSMUSP00000125776; ENSMUSG00000022185 [Q9JIX8-2]
GeneIDi56215
KEGGimmu:56215
UCSCiuc007twr.2 mouse [Q9JIX8-3]
uc007twv.2 mouse [Q9JIX8-1]
uc007twx.2 mouse [Q9JIX8-4]
uc011zld.1 mouse [Q9JIX8-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22985
MGIiMGI:1891824 Acin1

Phylogenomic databases

eggNOGiKOG2416 Eukaryota
ENOG4111HR1 LUCA
GeneTreeiENSGT00710000106790
HOGENOMiCLU_482284_0_0_1
InParanoidiQ9JIX8
KOiK12875
TreeFamiTF320727

Enzyme and pathway databases

ReactomeiR-MMU-111465 Apoptotic cleavage of cellular proteins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Acin1 mouse

Protein Ontology

More...
PROi
PR:Q9JIX8
RNActiQ9JIX8 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022185 Expressed in female gonad and 273 other tissues
ExpressionAtlasiQ9JIX8 baseline and differential
GenevisibleiQ9JIX8 MM

Family and domain databases

CDDicd12432 RRM_ACINU, 1 hit
Gene3Di1.10.720.30, 1 hit
3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR034257 Acinus_RRM
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR032552 RSB_motif
IPR003034 SAP_dom
IPR036361 SAP_dom_sf
PfamiView protein in Pfam
PF16294 RSB_motif, 1 hit
PF02037 SAP, 1 hit
SMARTiView protein in SMART
SM00513 SAP, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
SSF68906 SSF68906, 1 hit
PROSITEiView protein in PROSITE
PS50800 SAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACINU_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JIX8
Secondary accession number(s): B8JJ87
, Q9CSN7, Q9CSR9, Q9CSX7, Q9R046, Q9R047
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: July 27, 2011
Last modified: April 22, 2020
This is version 173 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again