We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q9JIL4 (NHRF3_MOUSE)

>sp|Q9JIL4|NHRF3_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Mus musculus OX=10090 GN=Pdzk1 PE=1 SV=1
MASTFNPRECKLSKQEGQNYGFFLRIEKDTDGHLIRVIEEGSPAEKAGLLDGDRVLRING
VFVDKEEHAQVVELVRKSGNSVTLLVLDGDSYEKAVKNQVDLKELDQSQREAALNDKKPG
PGMNGAVEPCAQPRLCYLVKEGNSFGFSLKTIQGKKGVYLTDIMPQGVAMKAGVLADDHL
IEVNGENVENASHEEVVEKVTKSGSRIMFLLVDKETARCHSEQKTQFKRETASLKLLPHQ
PRVVVIKKGSNGYGFYLRAGPEQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGKSVEALD
HDGVVEMIRKGGDQTTLLVLDKEAESIYSLARFSPLLYCQSQELPNGSVKEGPAPIPAPL
EATGSEPTEDAEGHKPKLCRLLKEDDSYGFHLNAIRGQPGSFVKEVQQGGPADKAGLENE
DVIIEVNGENVQEEPYDRVVERIKSSGKHVTLLVCGKMAYSYFQAKKIPIVSSMAEPLVA
GPDEKGETSAESEHDAHPAKDRTLSTASHSSSNSEDTEM

Entry version 170 (23 Feb 2022)
Sequence version 1 (01 Oct 2000)
Previous versions | rss

Add a publication Feedback

Protein

Na(+)/H(+) exchange regulatory cofactor NHE-RF3

Gene

Pdzk1

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

A scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. May be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. May play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. May potentiate the CFTR chloride channel activity (By similarity).

Required for normal cell-surface expression of SCARB1. Plays a role in maintaining normal plasma cholesterol levels via its effects on SCARB1. Plays a role in the normal localization and function of the chloride-anion exchanger SLC26A6 to the plasma membrane in the brush border of the proximal tubule of the kidney. May be involved in the regulation of proximal tubular Na⁺-dependent inorganic phosphate cotransport therefore playing an important role in tubule function.

By similarity7 Publications

Miscellaneous

Disruption of the gene was not associated with abnormal growth and development or redistribution of interacting proteins. However, a modulation of expression of selective ion channels in the kidney, as well as increased serum cholesterol levels were observed.

GO - Molecular functionⁱ

Complete GO annotation on QuickGO ...

GO - Biological processⁱ

Complete GO annotation on QuickGO ...

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Na(+)/H(+) exchange regulatory cofactor NHE-RF3 Short name: NHERF-3 Alternative name(s): CFTR-associated protein of 70 kDa Na(+)/H(+) exchanger regulatory factor 3 Na/Pi cotransporter C-terminal-associated protein 1 Short name: NaPi-Cap1 PDZ domain-containing protein 1 Sodium-hydrogen exchanger regulatory factor 3
Gene namesⁱ	Name:Pdzk1 Synonyms:Cap70, Nherf3
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Unplaced

Organism-specific databases

MGIⁱ	MGI:1928901, Pdzk1

Keywords - Cellular componentⁱ

Cell membrane, Membrane

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	14	K → A: Impairs interaction of the first PDZ domain with SCARB1. 1 Publication	1
Mutagenesisⁱ	20	Y → A: Disrupts interaction of the first PDZ domain with SCARB1. Abolishes interaction with SCARB1; when associated with A-253. 2 Publications	1
Mutagenesisⁱ	253	Y → A: Disrupts interaction of the third PDZ domain with SCARB1. Abolishes interaction with SCARB1; when associated with A-20. 1 Publication	1

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000058288	1 – 519	Na(+)/H(+) exchange regulatory cofactor NHE-RF3Add BLAST		519

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	108	PhosphoserineBy similarity	1
Modified residueⁱ	148	PhosphoserineCombined sources	1
Modified residueⁱ	192	PhosphoserineCombined sources	1
Modified residueⁱ	250	PhosphoserineCombined sources	1
Modified residueⁱ	334	PhosphoserineCombined sources	1
Modified residueⁱ	348	PhosphoserineCombined sources	1
Modified residueⁱ	451	PhosphothreonineCombined sources	1
Modified residueⁱ	488	PhosphothreonineCombined sources	1
Modified residueⁱ	489	PhosphoserineCombined sources	1
Modified residueⁱ	492	PhosphoserineCombined sources	1
Modified residueⁱ	503	PhosphothreonineCombined sources	1
Modified residueⁱ	508	PhosphoserineCombined sources	1
Modified residueⁱ	510	PhosphoserineCombined sources	1
Modified residueⁱ	511	PhosphoserineCombined sources	1
Modified residueⁱ	512	PhosphoserineCombined sources	1
Modified residueⁱ	514	PhosphoserineCombined sources	1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

jPOSTⁱ	Q9JIL4
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q9JIL4
PaxDbⁱ	Q9JIL4
PeptideAtlas More...PeptideAtlasⁱ	Q9JIL4
PRIDEⁱ	Q9JIL4
ProteomicsDBⁱ	252891

PTM databases

iPTMnetⁱ	Q9JIL4
PhosphoSitePlusⁱ	Q9JIL4
SwissPalmⁱ	Q9JIL4

Expressionⁱ

Tissue specificityⁱ

Interactionⁱ

Subunit structureⁱ

Interacts with PDZK1IP1 and ABCC2. Binds to the C-terminal region of SLC26A3.

Interacts (via C-terminal PDZ domain) with SLC26A6 (via C-terminal domain).

Interacts (via C-terminal PDZ domain) with SLC9A3 (via C-terminal domain) (By similarity).

Component of a complex, composed of PDZK1, SYNGAP1, KLHL17 and NMDA receptors.

Interacts (via PDZ1 domain) directly with KLHL17; the interaction is important for integrity of actin cytoskeleton structures in neurons (By similarity).

Forms a heterodimeric complex with SLC9A3R1.

Interacts with AKAP2, BCR, CFTR, SLCO1A1, SLC22A12, SLC22A4, SLC22A5, SLC26A6, SLC9A3R2 and SLC17A1.

Interacts (via the first PDZ domain) with PTGIR (via non-isoprenylated C-terminus).

Interacts (via PDZ domains 1 and 3) with SCARB1 (C-terminal domain).

By similarity7 Publications

GO - Molecular functionⁱ

PDZ domain binding Source: MGI
scavenger receptor binding Source: MGI

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGRIDⁱ	208488, 7 interactors
CORUMⁱ	Q9JIL4
IntActⁱ	Q9JIL4, 5 interactors
Molecular INTeraction database More...MINTⁱ	Q9JIL4
STRINGⁱ	10090.ENSMUSP00000102685

Miscellaneous databases

RNActⁱ	Q9JIL4, protein

RNActⁱ

Q9JIL4, protein

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	8 – 13	Combined sources	6
Beta strandⁱ	23 – 25	Combined sources	3
Beta strandⁱ	34 – 36	Combined sources	3
Helixⁱ	43 – 46	Combined sources	4
Beta strandⁱ	54 – 58	Combined sources	5
Beta strandⁱ	64 – 66	Combined sources	3
Helixⁱ	68 – 77	Combined sources	10
Turnⁱ	78 – 80	Combined sources	3
Beta strandⁱ	81 – 87	Combined sources	7
Helixⁱ	89 – 97	Combined sources	9
Helixⁱ	102 – 104	Combined sources	3
Beta strandⁱ	108 – 110	Combined sources	3
Beta strandⁱ	242 – 247	Combined sources	6
Beta strandⁱ	252 – 254	Combined sources	3
Beta strandⁱ	256 – 259	Combined sources	4
Beta strandⁱ	265 – 269	Combined sources	5
Helixⁱ	276 – 280	Combined sources	5
Beta strandⁱ	286 – 291	Combined sources	6
Helixⁱ	301 – 309	Combined sources	9
Turnⁱ	310 – 313	Combined sources	4
Beta strandⁱ	314 – 321	Combined sources	8
Beta strandⁱ	376 – 382	Combined sources	7
Beta strandⁱ	391 – 393	Combined sources	3
Beta strandⁱ	402 – 404	Combined sources	3
Helixⁱ	411 – 414	Combined sources	4
Beta strandⁱ	422 – 426	Combined sources	5
Helixⁱ	436 – 444	Combined sources	9
Beta strandⁱ	448 – 455	Combined sources	8

Show more details

3D structure databases

SMRⁱ	Q9JIL4
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q9JIL4

EvolutionaryTraceⁱ

Q9JIL4

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Domainⁱ	9 – 90	PDZ 1PROSITE-ProRule annotationAdd BLAST	82
Domainⁱ	128 – 215	PDZ 2PROSITE-ProRule annotationAdd BLAST	88
Domainⁱ	243 – 323	PDZ 3PROSITE-ProRule annotationAdd BLAST	81
Domainⁱ	378 – 458	PDZ 4PROSITE-ProRule annotationAdd BLAST	81

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	348 – 374	DisorderedSequence analysisAdd BLAST		27
Regionⁱ	479 – 519	DisorderedSequence analysisAdd BLAST		41

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	486 – 502	Basic and acidic residuesSequence analysisAdd BLAST		17
Compositional biasⁱ	503 – 519	Polar residuesSequence analysisAdd BLAST		17

Domainⁱ

The PDZ 2 and 3 domains seem to be involved in the interaction with SLC26A3.By similarity

Interaction with the C-terminus of CFTR could be mediated through independent binding of PDZ 1, 3 and 4 domains.

The PDZ 1 and 3 domains seem to be involved in the interaction with SLCO1A1.By similarity

The PDZ 1 domain interacts with BCR.By similarity

The PDZ 2 and 4 domains do not interact with the C-terminal region of SCARB1.

Sequence similaritiesⁱ

Belongs to the NHER family.Curated

Keywords - Domainⁱ

Repeat

Phylogenomic databases

eggNOGⁱ	KOG3528, Eukaryota
InParanoidⁱ	Q9JIL4
Database of Orthologous Groups More...OrthoDBⁱ	880632at2759
PhylomeDBⁱ	Q9JIL4
TreeFamⁱ	TF350449

Family and domain databases

Gene3Dⁱ	2.30.42.10, 4 hits
InterProⁱ	View protein in InterPro IPR001478, PDZ IPR036034, PDZ_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00595, PDZ, 4 hits
SMARTⁱ	View protein in SMART SM00228, PDZ, 4 hits
SUPFAMⁱ	SSF50156, SSF50156, 4 hits
PROSITEⁱ	View protein in PROSITE PS50106, PDZ, 4 hits

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 4 potential isoforms that are computationally mapped.Show all Align All

Q9JIL4-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MASTFNPREC KLSKQEGQNY GFFLRIEKDT DGHLIRVIEE GSPAEKAGLL 
        60         70         80         90        100
DGDRVLRING VFVDKEEHAQ VVELVRKSGN SVTLLVLDGD SYEKAVKNQV 
       110        120        130        140        150
DLKELDQSQR EAALNDKKPG PGMNGAVEPC AQPRLCYLVK EGNSFGFSLK 
       160        170        180        190        200
TIQGKKGVYL TDIMPQGVAM KAGVLADDHL IEVNGENVEN ASHEEVVEKV 
       210        220        230        240        250
TKSGSRIMFL LVDKETARCH SEQKTQFKRE TASLKLLPHQ PRVVVIKKGS 
       260        270        280        290        300
NGYGFYLRAG PEQKGQIIKD IEPGSPAEAA GLKNNDLVVA VNGKSVEALD 
       310        320        330        340        350
HDGVVEMIRK GGDQTTLLVL DKEAESIYSL ARFSPLLYCQ SQELPNGSVK 
       360        370        380        390        400
EGPAPIPAPL EATGSEPTED AEGHKPKLCR LLKEDDSYGF HLNAIRGQPG 
       410        420        430        440        450
SFVKEVQQGG PADKAGLENE DVIIEVNGEN VQEEPYDRVV ERIKSSGKHV 
       460        470        480        490        500
TLLVCGKMAY SYFQAKKIPI VSSMAEPLVA GPDEKGETSA ESEHDAHPAK 
       510 
DRTLSTASHS SSNSEDTEM

Length:519

Mass (Da):56,499

Last modified:October 1, 2000 - v1

Checksum:ⁱ681B57F4E237BC28

Computationally mapped potential isoform sequencesⁱ

There are 4 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A0A0R4J1V0	A0A0R4J1V0_MOUSE	Na(+)/H(+) exchange regulatory cofa... Na(+)/H(+) exchange regulatory cofactor NHE-RF3	Pdzk1	519	Annotation score:
D3YW13	D3YW13_MOUSE	Na(+)/H(+) exchange regulatory cofa... Na(+)/H(+) exchange regulatory cofactor NHE-RF3	Pdzk1	125	Annotation score:
D3YZS9	D3YZS9_MOUSE	Na(+)/H(+) exchange regulatory cofa... Na(+)/H(+) exchange regulatory cofactor NHE-RF3	Pdzk1	153	Annotation score:
D3Z114	D3Z114_MOUSE	Na(+)/H(+) exchange regulatory cofa... Na(+)/H(+) exchange regulatory cofactor NHE-RF3	Pdzk1	50	Annotation score:

Sequence cautionⁱ

The sequence AAL84634 differs from that shown. Reason: Frameshift.Curated

The sequence BAC26605 differs from that shown. Reason: Frameshift. The frameshift causes a read through of the stop codon.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	24	L → R in AAL84634 (PubMed:11051556).Curated	1
Sequence conflictⁱ	135	L → S in AAL84634 (PubMed:11051556).Curated	1
Sequence conflictⁱ	162	D → N in BAB24493 (PubMed:16141072).Curated	1
Sequence conflictⁱ	162	D → N in BAC26598 (PubMed:16141072).Curated	1
Sequence conflictⁱ	162	D → N in BAC26605 (PubMed:16141072).Curated	1
Sequence conflictⁱ	162	D → N in BAB28007 (PubMed:16141072).Curated	1
Sequence conflictⁱ	162	D → N in BAB29600 (PubMed:16141072).Curated	1
Sequence conflictⁱ	162	D → S in AAL84634 (PubMed:11051556).Curated	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF474247 mRNA Translation: AAL84634.1 Frameshift. AF220100 mRNA Translation: AAF73863.1 AK006269 mRNA Translation: BAB24493.1 AK029752 mRNA Translation: BAC26598.1 AK029764 mRNA Translation: BAC26605.1 Frameshift. AK012070 mRNA Translation: BAB28007.1 AK014879 mRNA Translation: BAB29600.1 BC013512 mRNA Translation: AAH13512.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS17649.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001139473.1, NM_001146001.1 NP_067492.2, NM_021517.2 XP_006501896.1, XM_006501833.2 XP_011238480.1, XM_011240178.2 XP_017175164.1, XM_017319675.1

Genome annotation databases

GeneIDⁱ	59020
KEGGⁱ	mmu:59020
UCSC genome browser More...UCSCⁱ	uc008qoi.2, mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9JIL4	NHRF3 protein (Fragment)		spotted wren-babbler		58	UniRef100_Q9JIL4
Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (Fragment)		MOUSE		153
Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (Fragment)		MOUSE		125
Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (Fragment)		MOUSE		50

Protein	Similar proteins		Species	Score	Length	Source
Q9JIL4	NHRF3 protein (Fragment)		spotted wren-babbler		58	UniRef90_Q9JIL4
Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (Fragment)		MOUSE		153
PDZ domain containing 1		MUSSI		575
Na(+)/H(+) exchange regulatory cofactor NHE-RF3		MUSCR		519
Na(+)/H(+) exchange regulatory cofactor NHE-RF3 (Fragment)		MOUSE		125
+6

Protein	Similar proteins		Species	Score	Length	Source
Q9JIL4	Na(+)/H(+) exchange regulatory cofactor NHE-RF3	)	HUMAN		519	UniRef50_Q5T2W1
Na(+)/H(+) exchange regulatory cofactor NHE-RF3		RAT		523
Na(+)/H(+) exchange regulatory cofactor NHE-RF3		RABIT		518
Na(+)/H(+) exchange regulatory cofactor NHE-RF3		PONAB		519
PDZ domain containing 1		MACFA		522
+593

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF474247 mRNA Translation: AAL84634.1 Frameshift. AF220100 mRNA Translation: AAF73863.1 AK006269 mRNA Translation: BAB24493.1 AK029752 mRNA Translation: BAC26598.1 AK029764 mRNA Translation: BAC26605.1 Frameshift. AK012070 mRNA Translation: BAB28007.1 AK014879 mRNA Translation: BAB29600.1 BC013512 mRNA Translation: AAH13512.1
CCDSⁱ	CCDS17649.1
RefSeqⁱ	NP_001139473.1, NM_001146001.1 NP_067492.2, NM_021517.2 XP_006501896.1, XM_006501833.2 XP_011238480.1, XM_011240178.2 XP_017175164.1, XM_017319675.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2D90	NMR	-	A	242-330	[»]
	2EDZ	NMR	-	A	1-107	[»]
	3NGH	X-ray	1.80	A/B	7-106	[»]
	3R68	X-ray	1.30	A	238-323	[»]
	3R69	X-ray	1.50	A/B	241-322	[»]
	4F8K	X-ray	1.70	A/B	7-106	[»]
	4R2Z	X-ray	1.70	A/B	375-459	[»]
SMRⁱ	Q9JIL4
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Protein-protein interaction databases

BioGRIDⁱ	208488, 7 interactors
CORUMⁱ	Q9JIL4
IntActⁱ	Q9JIL4, 5 interactors
MINTⁱ	Q9JIL4
STRINGⁱ	10090.ENSMUSP00000102685

PTM databases

iPTMnetⁱ	Q9JIL4
PhosphoSitePlusⁱ	Q9JIL4
SwissPalmⁱ	Q9JIL4

Proteomic databases

jPOSTⁱ	Q9JIL4
MaxQBⁱ	Q9JIL4
PaxDbⁱ	Q9JIL4
PeptideAtlasⁱ	Q9JIL4
PRIDEⁱ	Q9JIL4
ProteomicsDBⁱ	252891

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	59020

DNASUⁱ

59020

Genome annotation databases

GeneIDⁱ	59020
KEGGⁱ	mmu:59020
UCSCⁱ	uc008qoi.2, mouse

Organism-specific databases

CTDⁱ	5174
MGIⁱ	MGI:1928901, Pdzk1

Phylogenomic databases

eggNOGⁱ	KOG3528, Eukaryota
InParanoidⁱ	Q9JIL4
OrthoDBⁱ	880632at2759
PhylomeDBⁱ	Q9JIL4
TreeFamⁱ	TF350449

Miscellaneous databases

BioGRID-ORCSⁱ	59020, 2 hits in 64 CRISPR screens
ChiTaRSⁱ	Pdzk1, mouse
EvolutionaryTraceⁱ	Q9JIL4
Protein Ontology More...PROⁱ	PR:Q9JIL4
RNActⁱ	Q9JIL4, protein
SOURCEⁱ	Search...

Family and domain databases

Gene3Dⁱ	2.30.42.10, 4 hits
InterProⁱ	View protein in InterPro IPR001478, PDZ IPR036034, PDZ_sf
Pfamⁱ	View protein in Pfam PF00595, PDZ, 4 hits
SMARTⁱ	View protein in SMART SM00228, PDZ, 4 hits
SUPFAMⁱ	SSF50156, SSF50156, 4 hits
PROSITEⁱ	View protein in PROSITE PS50106, PDZ, 4 hits
MobiDBⁱ	Search...

Entry informationⁱ

Entry nameⁱ	NHRF3_MOUSE
Accessionⁱ	Q9JIL4Primary (citable) accession number: Q9JIL4 Secondary accession number(s): Q8CDP5, Q8R4G2, Q9CQ72
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 16, 2005
	Last sequence update:	October 1, 2000
	Last modified:	February 23, 2022
	This is version 170 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Direct protein sequencing, Reference proteome

Documents

MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
SIMILARITY comments
Index of protein domains and families

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9JIL4 (NHRF3_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Na(+)/H(+) exchange regulatory cofactor NHE-RF3

Pdzk1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Plasma membrane

Other locations

Plasma Membrane

Other locations

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Miscellaneous databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Compositional bias

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ