Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase WNK1

Gene

Wnk1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition (By similarity).By similarity5 Publications
Isoform 5: Dominant-negative regulator of the longer isoform 1. Does not have kinase activity, does not directly inhibit WNK4 and has no direct effect on sodium and chloride ion transport. Downregulates sodium-chloride cotransporter activity indirectly by inhibiting isoform 1, it associates with isoform 1 and attenuates its kinase activity. In kidney, may play an important role regulating sodium and potassium balance.1 Publication

Caution

Was named WNK/'with no lysine(K)' because key residues for catalysis, including the lysine involved in ATP binding, are either not conserved or differ compared to the residues described in other kinase family proteins.2 Publications
HSN2 was originally thought to be an intronless gene lying within a WNK1 gene intron. It has been shown to be an alternative exon of the WNK1 gene in other mammalian species, including human and mouse. Isoforms bearing this exon (isoform 2 and isoform 3 in this entry) are specifically expressed in the nervous system in these species. system.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+1 Publication

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

By hypertonicity. Activation requires autophosphorylation of Ser-382, that may be regulated by calcium. Phosphorylation of Ser-378 also promotes increased activity.3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei231ATP; via amide nitrogenBy similarity1
Binding sitei351ATPBy similarity1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei368Proton acceptor1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi301 – 304ATPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • chloride channel inhibitor activity Source: GO_Central
  • magnesium ion binding Source: RGD
  • phosphatase binding Source: UniProtKB
  • potassium channel inhibitor activity Source: RGD
  • protein kinase activator activity Source: Ensembl
  • protein kinase binding Source: RGD
  • protein serine/threonine kinase activity Source: UniProtKB
  • protein serine/threonine kinase inhibitor activity Source: RGD

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Protein kinase inhibitor, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-2672351 Stimuli-sensing channels

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase WNK1Curated (EC:2.7.11.12 Publications)
Alternative name(s):
Protein kinase lysine-deficient 1Imported
Protein kinase with no lysine 11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Wnk1Imported
Synonyms:Hsn21 Publication, Prkwnk1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Rat genome database

More...
RGDi
621141 Wnk1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi233K → G: Loss of kinase activity; when associated with K-250. 2 Publications1
Mutagenesisi233K → M: Loss of kinase activity. 2 Publications1
Mutagenesisi250C → A: No effect on kinase activity. 2 Publications1
Mutagenesisi250C → K: Reduced kinase activity. Loss of kinase activity; when associated with G-233. 2 Publications1
Mutagenesisi256K → M: No effect on kinase activity. 1 Publication1
Mutagenesisi259K → M: No effect on kinase activity. 1 Publication1
Mutagenesisi368D → A: Loss of kinase activity. 1 Publication1
Mutagenesisi369L → F: Decreased calcium-dependent inhibition of autophosphorylation. 1 Publication1
Mutagenesisi371L → F: Decreased calcium-dependent inhibition of autophosphorylation. 1 Publication1
Mutagenesisi378S → A: Reduced kinase activity. 1 Publication1
Mutagenesisi378S → D: Increased kinase activity. 1 Publication1
Mutagenesisi382S → A: Loss of kinase activity. 1 Publication1
Mutagenesisi382S → D: Loss of kinase activity. 1 Publication1
Mutagenesisi524F → A: Reduced ability of autoinhibitory domain to regulate kinase activity. 1 Publication1
Mutagenesisi526F → A: Reduced ability of autoinhibitory domain to regulate kinase activity. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000868211 – 2126Serine/threonine-protein kinase WNK1Add BLAST2126

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei17PhosphoserineBy similarity1
Modified residuei165PhosphoserineCombined sources1
Modified residuei172PhosphoserineCombined sources1
Modified residuei378Phosphoserine; by autocatalysis1 Publication1
Modified residuei382Phosphoserine; by autocatalysis1 Publication1
Modified residuei1007PhosphoserineBy similarity1
Modified residuei1723PhosphoserineBy similarity1
Modified residuei1755PhosphoserineBy similarity1
Modified residuei1756PhosphoserineBy similarity1
Modified residuei1771PhosphoserineBy similarity1
Modified residuei1773PhosphoserineCombined sources1
Modified residuei1776PhosphoserineCombined sources1
Modified residuei1865PhosphoserineBy similarity1
Modified residuei2014PhosphoserineBy similarity1
Modified residuei2030PhosphoserineBy similarity1
Modified residuei2114PhosphoserineBy similarity1
Modified residuei2116PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autophosphorylation at Ser-382 is inhibited by intracellular calcium.1 Publication
Ubiquitinated in vitro by the BCR(KLHL3) complex and in vivo by a BCR(KLHL2) complex, leading to proteasomal degradation.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9JIH7

PRoteomics IDEntifications database

More...
PRIDEi
Q9JIH7

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q9JIH7

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9JIH7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9JIH7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000009956 Expressed in 9 organ(s), highest expression level in Ammon's horn

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9JIH7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9JIH7 RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SYT2. Interacts with KLHL3, WNK3 and WNK4 (PubMed:17975670). Isoform 5: Interacts with isoform 1 (PubMed:16204408).3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Syt2P291019EBI-457953,EBI-458017

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9JIH7, 6 interactors

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000013355

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12126
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9JIH7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9JIH7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9JIH7

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini221 – 479Protein kinasePROSITE-ProRule annotationAdd BLAST259

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni488 – 555Autoinhibitory domain1 PublicationAdd BLAST68

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0584 Eukaryota
ENOG410XQWZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155474

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168221

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG048577

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9JIH7

KEGG Orthology (KO)

More...
KOi
K08867

Identification of Orthologs from Complete Genome Data

More...
OMAi
HFLPMGQ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9JIH7

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR024678 Kinase_OSR1/WNK_CCT
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12202 OSR1_C, 1 hit
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9JIH7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDGTAEKQS GTPGFLSPPA PVPKNGSSSD SSVGEKLGAA VADSGIGRTE
60 70 80 90 100
EYRRRRHTMD KDSRGAAATT TPTEHRFFRR SVICDSNATA LELPGLPLSI
110 120 130 140 150
PQPSVPAVVP QSAPPEPHRE ETLTATVASQ VSQQPSAAAS PGEQAVVGSA
160 170 180 190 200
TATVPSSTSK DRPVSQPSLV GSKEEPPPSR SGSGSGGASA KEPQEERNQQ
210 220 230 240 250
QDDIEELETK AVGMSNDGRF LKFDIEIGRG SFKTVYKGLD TETTVEVAWC
260 270 280 290 300
ELQDRKLTKS ERQRFKEEAE MLKGLQHPNI VRFYDSWEST VKGKKCIVLV
310 320 330 340 350
TELMTSGTLK TYLKRFKVMK IKVLRSWCRQ ILKGLQFLHT RTPPIIHRDL
360 370 380 390 400
KCDNIFITGP TGSVKIGDLG LATLKRASFA KSVIGTPEFM APEMYEEKYD
410 420 430 440 450
ESVDVYAFGM CMLEMATSEY PYSECQNAAQ IYRRVTSGVK PASFDKVAIP
460 470 480 490 500
EVKEIIEGCI RQNKDERYSI KDLLNHAFFQ EETGVRVELA EEDDGEKIAI
510 520 530 540 550
KLWLRIEDIK KLKGKYKDNE AIEFSFDLER DVPEDVAQEM VESGYVCEGD
560 570 580 590 600
HKTMAKAIKD RVSLIKRKRE QRQLVREEQE KRKQEESSFK QQNEQQASVS
610 620 630 640 650
QAGIQPLSVA STGIPTAPTT SASVSTQVEP EEPEADQHQQ LQYQQPSISV
660 670 680 690 700
LSDGTVDSGQ GSSVFTESRV SSQQTVSYGS QHEQAHSIGT APGHTVSSIQ
710 720 730 740 750
AQSQPHGVYP PSSMAQGQNQ GQPSSSLAGV LSSQPVQHPQ QQGIQPTVPP
760 770 780 790 800
QQAVQYSLPQ AASSSEGTVQ PVSQPQVSAG TQSSTQGVSQ AAPPEQTPIT
810 820 830 840 850
QSQPTQPVPL VSSVDSAHSD VASGMSDGNE NAPSSSGRHE GRTTKRHYRK
860 870 880 890 900
SVRSRSRHEK TSRPKLRILN VSNKGDRVVE CQLETHNRKM VTFKFDLDGD
910 920 930 940 950
NPEEIATIMV NNDFILAIER ESFVAQVREI IEKADEMLSE DVSVEPEGDQ
960 970 980 990 1000
GLESLQGKDD YGFPGSQKLE GEFKQPIAVS SMPQQIGVPT SSLTQVVHSA
1010 1020 1030 1040 1050
GRRFIVSPVP ESRLRESKIF TSEIPDPVAA STSQGPGMNL SHSASSLSLQ
1060 1070 1080 1090 1100
QAFSELKHGQ MTEGPNTAPP NFNHPGPTFS PFLTSIAGVQ TVAASTPSVS
1110 1120 1130 1140 1150
VPITSSPLND ISTSVMQSEG ALPTDKGIGG VTTSTGVVAS GGLTTLSVSE
1160 1170 1180 1190 1200
TPTLSSAVSS STAPAVVTVS TTSQPVQAST SGSIASSTGS FPSGTFSTTT
1210 1220 1230 1240 1250
GTTVSSVAVP NAKPPTVLLQ QVAGNTAGVA IVTSVSTTTP FPAMASQPSL
1260 1270 1280 1290 1300
PLGSSTSAPT LAETVVVSAH SLDKASHSST AGLGLSFCAP SSSSSSGTAV
1310 1320 1330 1340 1350
SSSVSQPGIV HPLVISSAIA STPVLPQPAV PTSTPLLPQV PNIPPLVQPV
1360 1370 1380 1390 1400
ANVPAVQQTL IHSQPQPALL PNQPHTHCPE MDADTQSKAP GIDDIKTLEE
1410 1420 1430 1440 1450
KLRSLFSEHS SSGTQHASVS LETPLVVETV TPGIPTTAVA PSKLMTSTTS
1460 1470 1480 1490 1500
TCLPPTNLPL GTAGMPVMPV GTPGQVSTPG THASAPASTA TGAKPGTTPP
1510 1520 1530 1540 1550
KPSLTKTVVP PVGTELSAGT VPCEQLPPFP GPSLIQTQQP LEDLDAQLRR
1560 1570 1580 1590 1600
TLSPETIPVT PAVGPLSTMS STAVTEAGSQ PQKDGTEVHV TASSSGAGVV
1610 1620 1630 1640 1650
KMGRFQVSVT MDDAQKERKN RSEDTKSVHF ESSTSESSVL SSSSPESTLV
1660 1670 1680 1690 1700
KPEPNGITVS GISLDVPDST HRTPTPEAKS ETGQPTKVGR FQVTTTANKV
1710 1720 1730 1740 1750
GRFSVSRTED KVTELKKEGP VTSPFRDSEQ TVIPAAIPKK EKPELAEPSH
1760 1770 1780 1790 1800
LNGPSSDLEA AFLSRGGEDG SGSPHSPPHL CSKSLPIQTL SQSLSNSFNS
1810 1820 1830 1840 1850
SYMSSDNESD IEDEDLRLEL RRLREKHLKE IQDLQSRQKH EIESLYTKLG
1860 1870 1880 1890 1900
KVPPAVIIPP AAPLSGRRRR PTKSKGSKSS RSSSLGNKSP QLSGNLSGQS
1910 1920 1930 1940 1950
GTSVLNPQQT LHPPGNTPET GHNQLLQPLK PSPSSDNLYS AFTSDGAISV
1960 1970 1980 1990 2000
PSLSAPGQGT SSTNTVGGTV SSQAAQAQPP AMTSSRKGTF TDDLHKLVDN
2010 2020 2030 2040 2050
WARDAMNLSG RRGSKGHMNY EGPGMARKFS APGQLCISMT SNMGGSTPIS
2060 2070 2080 2090 2100
AASATSLGHF TKSMCPPQQY GFPAAPFGTQ WSGTGGPAPQ PLGQFQPVGT
2110 2120
TSLQNFNISN LQKSISNPPG SNLRTT
Length:2,126
Mass (Da):225,112
Last modified:November 30, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i89AC72F9CC8B07DF
GO
Isoform 2 (identifier: Q9JIH7-3) [UniParc]FASTAAdd to basket
Also known as: Brain and spinal cord variant

The sequence of this isoform differs from the canonical sequence as follows:
     714-714: M → MPRRGRSMSV...SSGGSALHPQ

Note: This isoform which includes the HSN2 exon has been identified in human and mouse. The sequence shown here is the result of gene prediction.
Show »
Length:2,625
Mass (Da):278,978
Checksum:i3A08561C46528F28
GO
Isoform 3 (identifier: Q9JIH7-2) [UniParc]FASTAAdd to basket
Also known as: Dorsal root ganglia and sciatic nerve variant, DRG and sciatic nerve variant

The sequence of this isoform differs from the canonical sequence as follows:
     714-714: M → MPQSVAHPCG...SSGGSALHPQ
     782-782: Q → QGFPSRLPPQ...TTSSQQAVLE

Note: This isoform which includes the HSN2 exon has been identified in human and mouse. The sequence shown here is the result of gene prediction.
Show »
Length:2,634
Mass (Da):279,566
Checksum:i16F6B2F0666858C7
GO
Isoform 4 (identifier: Q9JIH7-4) [UniParc]FASTAAdd to basket
Also known as: KS-WNK1-long, Kidney-Specific long form1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-437: MSDGTAEKQS...AAQIYRRVTS → MVVCISIYFP...CCSQKDCINE
     543-2126: Missing.

Note: Kinase-defective isoform. Produced by alternative promoter usage and alternative splicing.1 Publication
Show »
Length:160
Mass (Da):18,469
Checksum:i8FE8F697EDF503E5
GO
Isoform 5 (identifier: Q9JIH7-5) [UniParc]FASTAAdd to basket
Also known as: KS-WNK1-short, Kidney-Specific short form1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-437: MSDGTAEKQS...AAQIYRRVTS → MDFLKKDFCSVFVIVNSHCCCCSQKDCINE
     543-2126: Missing.

Note: Kinase-defective isoform. Produced by alternative promoter usage and alternative splicing.1 Publication
Show »
Length:135
Mass (Da):15,625
Checksum:i652E0035E5454FE8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2K3A0A0A0G2K3A0_RAT
Serine/threonine-protein kinase WNK...
Wnk1
2,164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence DAA04492 differs from that shown. Reason: Erroneous gene model prediction. Includes 3' and 3' intronic sequences.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1179S → F in AAF74258 (PubMed:10828064).Curated1
Sequence conflicti1950V → I in AAF74258 (PubMed:10828064).Curated1
Sequence conflicti2120G → S in AAF74258 (PubMed:10828064).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0585941 – 437MSDGT…RRVTS → MVVCISIYFPPSFFLNSIKS VLPFLMDFLKKDFCSVFVIV NSHCCCCSQKDCINE in isoform 4. Add BLAST437
Alternative sequenceiVSP_0585951 – 437MSDGT…RRVTS → MDFLKKDFCSVFVIVNSHCC CCSQKDCINE in isoform 5. Add BLAST437
Alternative sequenceiVSP_058596543 – 2126Missing in isoform 4 and isoform 5. Add BLAST1584
Alternative sequenceiVSP_040279714M → MPRRGRSMSVCVPHLSAVPS LSRISPSAPSTPPPVLSAPL CPSLLRSAPEETFAEKLSKA LESVLPMHSASQRKHRRSSL PSLFVTTPQSVAHPCGGTPT YPESQIFFPTIHERPVSFSP PPTCPPKVAISQRRKSTSFL EAQTRHFQPLLRTVGQNHLP PGGSPTNWTPEAIVMLGTTA NRVNRELCEMQVQPVFETTQ IYSDYRPGLVLAEEAHYFIP QETVYLAGVHYQAHAAGQYE GISYNSPVLSSPMKQITEQK PVPGCPASSSVFEFPSGQAF LVGHLQNLRLDSGPSPASPL SSISAPNSTDATHLKFHPVF VPHSAPAVLTHSNENRSNCV FEFHAQTPSSSSGEGGGILP QRVYRNRQVAVDSSQEELSP QSVGLHCHLQPVTEEQRNNH TPELTISVVEPMGQNWPVGS PEYSSDSSQITSSDISDFQS PPPTGGTAAPFGSDVSLPYI RLPQTVLQESPLFFCFPQGT TSQQVLSASYSSGGSALHPQ in isoform 2. Curated1
Alternative sequenceiVSP_040278714M → MPQSVAHPCGGTPTYPESQI FFPTIHERPVSFSPPPTCPP KVAISQRRKSTSFLEAQTRH FQPLLRTVGQNHLPPGGSPT NWTPEAIVMLGTTANRVNRE LCEMQVQPVFETTQIYSDYR PGLVLAEEAHYFIPQETVYL AGVHYQAHAAGQYEGISYNS PVLSSPMKQITEQKPVPGCP ASSSVFEFPSGQAFLVGHLQ NLRLDSGPSPASPLSSISAP NSTDATHLKFHPVFVPHSAP AVLTHSNENRSNCVFEFHAQ TPSSSSGEGGGILPQRVYRN RQVAVDSSQEELSPQSVGLH CHLQPVTEEQRNNHTPELTI SVVEPMGQNWPVGSPEYSSD SSQITSSDISDFQSPPPTGG TAAPFGSDVSLPYIRLPQTV LQESPLFFCFPQGTTSQQVL SASYSSGGSALHPQ in isoform 3. Curated1
Alternative sequenceiVSP_040280782Q → QGFPSRLPPQYPGDSNIAPS SNVASVCIHSTVLAPPPMPT EALATQGYFPTVVQPYVEST PLVPMGSVGGQVQVSQPAVS LSQQPPTTSSQQAVLE in isoform 3. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF227741 mRNA Translation: AAF74258.1
DQ177457 mRNA Translation: ABA02202.1
AC106348 Genomic DNA No translation available.
BK004106 Genomic DNA Translation: DAA04492.1 Sequence problems.

NCBI Reference Sequences

More...
RefSeqi
NP_001002823.2, NM_001002823.2 [Q9JIH7-2]
NP_001186024.1, NM_001199095.1 [Q9JIH7-3]
NP_446246.2, NM_053794.2 [Q9JIH7-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Rn.27409

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000013355; ENSRNOP00000013355; ENSRNOG00000009956 [Q9JIH7-2]
ENSRNOT00000013621; ENSRNOP00000013622; ENSRNOG00000009956 [Q9JIH7-3]
ENSRNOT00000080788; ENSRNOP00000072173; ENSRNOG00000009956 [Q9JIH7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
116477

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:116477

UCSC genome browser

More...
UCSCi
RGD:621141 rat [Q9JIH7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF227741 mRNA Translation: AAF74258.1
DQ177457 mRNA Translation: ABA02202.1
AC106348 Genomic DNA No translation available.
BK004106 Genomic DNA Translation: DAA04492.1 Sequence problems.
RefSeqiNP_001002823.2, NM_001002823.2 [Q9JIH7-2]
NP_001186024.1, NM_001199095.1 [Q9JIH7-3]
NP_446246.2, NM_053794.2 [Q9JIH7-1]
UniGeneiRn.27409

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LRUNMR-A480-572[»]
3FPQX-ray1.80A/B194-483[»]
4Q2AX-ray3.50A194-480[»]
5DRBX-ray1.65A194-483[»]
5W7TX-ray2.01A/B210-482[»]
ProteinModelPortaliQ9JIH7
SMRiQ9JIH7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9JIH7, 6 interactors
STRINGi10116.ENSRNOP00000013355

PTM databases

CarbonylDBiQ9JIH7
iPTMnetiQ9JIH7
PhosphoSitePlusiQ9JIH7

Proteomic databases

PaxDbiQ9JIH7
PRIDEiQ9JIH7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000013355; ENSRNOP00000013355; ENSRNOG00000009956 [Q9JIH7-2]
ENSRNOT00000013621; ENSRNOP00000013622; ENSRNOG00000009956 [Q9JIH7-3]
ENSRNOT00000080788; ENSRNOP00000072173; ENSRNOG00000009956 [Q9JIH7-1]
GeneIDi116477
KEGGirno:116477
UCSCiRGD:621141 rat [Q9JIH7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65125
RGDi621141 Wnk1

Phylogenomic databases

eggNOGiKOG0584 Eukaryota
ENOG410XQWZ LUCA
GeneTreeiENSGT00940000155474
HOGENOMiHOG000168221
HOVERGENiHBG048577
InParanoidiQ9JIH7
KOiK08867
OMAiHFLPMGQ
PhylomeDBiQ9JIH7

Enzyme and pathway databases

ReactomeiR-RNO-2672351 Stimuli-sensing channels

Miscellaneous databases

EvolutionaryTraceiQ9JIH7

Protein Ontology

More...
PROi
PR:Q9JIH7

Gene expression databases

BgeeiENSRNOG00000009956 Expressed in 9 organ(s), highest expression level in Ammon's horn
ExpressionAtlasiQ9JIH7 baseline and differential
GenevisibleiQ9JIH7 RN

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR024678 Kinase_OSR1/WNK_CCT
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF12202 OSR1_C, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWNK1_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9JIH7
Secondary accession number(s): Q3S2I2, Q6IFS7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: November 30, 2010
Last modified: December 5, 2018
This is version 162 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again