Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor-interacting protein 2

Gene

Nrip2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Down-regulates transcriptional activation by nuclear receptors, such as NR1F2.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processTranscription, Transcription regulation

Protein family/group databases

MEROPSiA28.002

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor-interacting protein 2
Alternative name(s):
Neuronal-interacting factor X 1
Gene namesi
Name:Nrip2
Synonyms:Nix1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1891884 Nrip2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002710571 – 270Nuclear receptor-interacting protein 2Add BLAST270

Proteomic databases

PaxDbiQ9JHR9
PRIDEiQ9JHR9

PTM databases

PhosphoSitePlusiQ9JHR9

Expressioni

Tissue specificityi

Expression is restricted to the central nervous system (neurons in the dentate gyrus of the hippocampus, the amygdala, thalamic and hypothalamic regions).1 Publication

Gene expression databases

BgeeiENSMUSG00000001520 Expressed in 215 organ(s), highest expression level in retina
CleanExiMM_NRIP2
ExpressionAtlasiQ9JHR9 baseline and differential
GenevisibleiQ9JHR9 MM

Interactioni

Subunit structurei

Interacts with NR1F2, RARA and THRB in a ligand-dependent manner.1 Publication

Protein-protein interaction databases

BioGridi208553, 4 interactors
IntActiQ9JHR9, 2 interactors
STRINGi10090.ENSMUSP00000113317

Structurei

3D structure databases

ProteinModelPortaliQ9JHR9
SMRiQ9JHR9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni61 – 99Interaction with NR1F21 PublicationAdd BLAST39

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi192 – 196LXXLL motif5

Phylogenomic databases

eggNOGiKOG0012 Eukaryota
ENOG410XPA0 LUCA
GeneTreeiENSGT00510000046989
HOGENOMiHOG000236257
HOVERGENiHBG103468
InParanoidiQ9JHR9
KOiK13215
OMAiLKCCIDL
OrthoDBiEOG091G0L7S
PhylomeDBiQ9JHR9
TreeFamiTF333421

Family and domain databases

Gene3Di2.40.70.10, 1 hit
InterProiView protein in InterPro
IPR019103 Peptidase_aspartic_DDI1-type
IPR021109 Peptidase_aspartic_dom_sf
PfamiView protein in Pfam
PF09668 Asp_protease, 1 hit
SUPFAMiSSF50630 SSF50630, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9JHR9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTGQEARRD EGDSRKEQEA SLRDRAHLSQ QRQLKQATQF LHKDSADLLP
60 70 80 90 100
LDSLKRLGTS KDLQPHSVIQ RRLVEGNQRR LQGESPLLQA LIRGHDSSRT
110 120 130 140 150
SATQVPALLV NCKCQDQMLR VAVDTGTQHN QISAGCLRRL GLGKRVPKAP
160 170 180 190 200
GGDVAPEPPT QVEQLELELG QETVACSAQV VDVDSPEFCL GLQTLLSLKL
210 220 230 240 250
ATSLSASSLL PSALGIPTES ICDSEALVPH SLLSLPKCTT KSLTEKDLQQ
260 270
MGSRLHPGCR GQSYLLPPLA
Note: No experimental confirmation available.
Length:270
Mass (Da):29,284
Last modified:January 9, 2007 - v2
Checksum:iEC001C2E290F5CCE
GO
Isoform 2 (identifier: Q9JHR9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-270: LATSLSASSL...GQSYLLPPLA → CCIDLDRGVLRLKAPFSELPFLPLYQEPGQ

Show »
Length:229
Mass (Da):25,272
Checksum:iAA8606CEC4076AD7
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QAD1E9QAD1_MOUSE
Nuclear receptor-interacting protei...
Nrip2
219Annotation score:
A0A0N4SUN5A0A0N4SUN5_MOUSE
Nuclear receptor-interacting protei...
Nrip2
190Annotation score:
F7BIJ5F7BIJ5_MOUSE
Nuclear receptor-interacting protei...
Nrip2
113Annotation score:

Sequence cautioni

The sequence BAE22242 differs from that shown. Reason: Frameshift at position 240.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti32R → L in BAE22242 (PubMed:16141072).Curated1
Sequence conflicti33Q → R in BAE33744 (PubMed:16141072).Curated1
Sequence conflicti48L → P in CAB95737 (PubMed:10860982).Curated1
Sequence conflicti147P → T in BAE22242 (PubMed:16141072).Curated1
Sequence conflicti158P → S in BAE33744 (PubMed:16141072).Curated1
Sequence conflicti163E → Q in BAE22242 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_022275200 – 270LATSL…LPPLA → CCIDLDRGVLRLKAPFSELP FLPLYQEPGQ in isoform 2. 3 PublicationsAdd BLAST71

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278170 mRNA Translation: CAB95737.1
AK134689 mRNA Translation: BAE22242.1 Frameshift.
AK156526 mRNA Translation: BAE33744.1
BC115523 mRNA Translation: AAI15524.1
CCDSiCCDS20571.1 [Q9JHR9-2]
CCDS51917.1 [Q9JHR9-1]
RefSeqiNP_001156330.1, NM_001162858.1 [Q9JHR9-1]
NP_068363.2, NM_021717.2 [Q9JHR9-2]
UniGeneiMm.269883

Genome annotation databases

EnsembliENSMUST00000001561; ENSMUSP00000001561; ENSMUSG00000001520 [Q9JHR9-2]
ENSMUST00000120405; ENSMUSP00000113317; ENSMUSG00000001520 [Q9JHR9-1]
GeneIDi60345
KEGGimmu:60345
UCSCiuc009edn.2 mouse [Q9JHR9-2]
uc012etb.1 mouse [Q9JHR9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ278170 mRNA Translation: CAB95737.1
AK134689 mRNA Translation: BAE22242.1 Frameshift.
AK156526 mRNA Translation: BAE33744.1
BC115523 mRNA Translation: AAI15524.1
CCDSiCCDS20571.1 [Q9JHR9-2]
CCDS51917.1 [Q9JHR9-1]
RefSeqiNP_001156330.1, NM_001162858.1 [Q9JHR9-1]
NP_068363.2, NM_021717.2 [Q9JHR9-2]
UniGeneiMm.269883

3D structure databases

ProteinModelPortaliQ9JHR9
SMRiQ9JHR9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi208553, 4 interactors
IntActiQ9JHR9, 2 interactors
STRINGi10090.ENSMUSP00000113317

Protein family/group databases

MEROPSiA28.002

PTM databases

PhosphoSitePlusiQ9JHR9

Proteomic databases

PaxDbiQ9JHR9
PRIDEiQ9JHR9

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000001561; ENSMUSP00000001561; ENSMUSG00000001520 [Q9JHR9-2]
ENSMUST00000120405; ENSMUSP00000113317; ENSMUSG00000001520 [Q9JHR9-1]
GeneIDi60345
KEGGimmu:60345
UCSCiuc009edn.2 mouse [Q9JHR9-2]
uc012etb.1 mouse [Q9JHR9-1]

Organism-specific databases

CTDi83714
MGIiMGI:1891884 Nrip2

Phylogenomic databases

eggNOGiKOG0012 Eukaryota
ENOG410XPA0 LUCA
GeneTreeiENSGT00510000046989
HOGENOMiHOG000236257
HOVERGENiHBG103468
InParanoidiQ9JHR9
KOiK13215
OMAiLKCCIDL
OrthoDBiEOG091G0L7S
PhylomeDBiQ9JHR9
TreeFamiTF333421

Miscellaneous databases

PROiPR:Q9JHR9
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000001520 Expressed in 215 organ(s), highest expression level in retina
CleanExiMM_NRIP2
ExpressionAtlasiQ9JHR9 baseline and differential
GenevisibleiQ9JHR9 MM

Family and domain databases

Gene3Di2.40.70.10, 1 hit
InterProiView protein in InterPro
IPR019103 Peptidase_aspartic_DDI1-type
IPR021109 Peptidase_aspartic_dom_sf
PfamiView protein in Pfam
PF09668 Asp_protease, 1 hit
SUPFAMiSSF50630 SSF50630, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNRIP2_MOUSE
AccessioniPrimary (citable) accession number: Q9JHR9
Secondary accession number(s): Q14BZ2, Q3U0V7, Q3UYH0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: January 9, 2007
Last modified: September 12, 2018
This is version 107 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again