Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 112 (16 Oct 2019)
Sequence version 1 (01 Oct 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

CUGBP Elav-like family member 1

Gene

celf1

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding protein implicated in the regulation of several post-transcriptional events. May be involved in mRNA translation activation and stability (By similarity). Involved in the regulation of muscle-specific splicing of alpha actinin pre-mRNAs via the binding to the UR-repeat element (URE) at the branch point of the non-muscle (NM) exon.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • mRNA 3'-UTR binding Source: ZFIN
  • mRNA binding Source: ZFIN
  • RNA binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, RNA-binding
Biological processmRNA processing, mRNA splicing

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CUGBP Elav-like family member 1
Short name:
CELF-1
Alternative name(s):
Bruno-like protein 2
CUG triplet repeat RNA-binding protein 1
Short name:
CUG-BP1
CUG-BP- and ETR-3-like factor 1
EDEN-BP/Bruno-like protein
RNA-binding protein BRUNOL-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:celf1
Synonyms:brul, cugbp1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7955 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000437 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Zebrafish Information Network genome database

More...
ZFINi
ZDB-GENE-000501-1 celf1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002951851 – 501CUGBP Elav-like family member 1Add BLAST501

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9IBD0

PRoteomics IDEntifications database

More...
PRIDEi
Q9IBD0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the vegetal cortex of the oocyte. Expressed uniformly in the embryo. Expressed in the vegetal pole at 0.08 hour post-fertilization (hpf). Expressed in the lens fiber cells at 24 hpf and in the blastodisc of the zygote at 30 hpf.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSDARG00000005315 Expressed in 38 organ(s), highest expression level in mature ovarian follicle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9IBD0 baseline

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
7955.ENSDARP00000111278

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9IBD0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini16 – 99RRM 1PROSITE-ProRule annotationAdd BLAST84
Domaini108 – 188RRM 2PROSITE-ProRule annotationAdd BLAST81
Domaini416 – 494RRM 3PROSITE-ProRule annotationAdd BLAST79

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 196Binds strongly to UREAdd BLAST195
Regioni397 – 501Binds strongly to UREAdd BLAST105

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi261 – 269Poly-Ala9
Compositional biasi277 – 321Ser-richAdd BLAST45

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CELF/BRUNOL family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0144 Eukaryota
ENOG410XNTW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158970

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000004754

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9IBD0

KEGG Orthology (KO)

More...
KOi
K13207

Identification of Orthologs from Complete Genome Data

More...
OMAi
DHCSLNA

Database of Orthologous Groups

More...
OrthoDBi
1209165at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9IBD0

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12631 RRM1_CELF1_2_Bruno, 1 hit
cd12634 RRM2_CELF1_2, 1 hit
cd12638 RRM3_CELF1_2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR034196 CELF1/2_RRM1
IPR034198 CELF1/2_RRM2
IPR034199 CELF1/2_RRM3
IPR002343 Hud_Sxl_RNA
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076 RRM_1, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00961 HUDSXLRNA

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9IBD0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGSLDHPDQ PDIDSIKMFV GQIPRTWSED QLRELFEPYG AVYEINVLRD
60 70 80 90 100
RSQNPPQSKG CCFVTYYTRK SALEAQNALH NMKILPGMHH PIQMKPADSE
110 120 130 140 150
KNNAVEDRKL FVGMISKKCN ENDIRLMFSP YGQIEECRIL RGPDGLSRGC
160 170 180 190 200
AFVTFTARQM AQSAIKSMHQ SQTMEGCSSP IVVKFADTQK DKEQKRIAQQ
210 220 230 240 250
LQQQMQQLNA ASMWGNLTGL NSLGPQYLAL YLQLLQQSAS SGNALNNLHP
260 270 280 290 300
MSGLNAMQNL AALAAAASAT QATPTGSSAL TTSSSPLSVL TSSGTPSGQP
310 320 330 340 350
AQSAWDAYKA GSSPTSSTSS SVNPMASLGA LQSLAAGAGA GLNMSSLASM
360 370 380 390 400
AALNGGLGSG GLSNGSGSTM EALTQAAYSG IQQYAAAALP SLYSQSLLSQ
410 420 430 440 450
QNVSAAGSQK EGPEGANLFI YHLPQEFGDQ DLLQMFMPFG NVISAKVFID
460 470 480 490 500
KQTNLSKCFG FVSYDNPVSS QAAIQSMNGF QIGMKRLKVQ LKRSKNDSKP

Y
Length:501
Mass (Da):53,608
Last modified:October 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA1391FF0F7A839B2
GO
Isoform 2 (identifier: Q9IBD0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDSIEAEALYLTTAQHGQPQCELSLPAVEVPALGGSKKM
     149-149: Missing.
     230-233: Missing.

Show »
Length:534
Mass (Da):56,998
Checksum:iEFA4A0EF52EE46C2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QEH4E9QEH4_DANRE
CUGBP Elav-like family member 1
celf1
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QIE8E9QIE8_DANRE
CUGBP Elav-like family member 1
celf1
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0267911M → MDSIEAEALYLTTAQHGQPQ CELSLPAVEVPALGGSKKM in isoform 2. 1 Publication1
Alternative sequenceiVSP_026792149Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_026793230 – 233Missing in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB032726 mRNA Translation: BAA95119.1
BC049453 mRNA Translation: AAH49453.1

NCBI Reference Sequences

More...
RefSeqi
NP_001315342.1, NM_001328413.1 [Q9IBD0-2]
NP_571688.1, NM_131613.2 [Q9IBD0-1]
XP_017212394.1, XM_017356905.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSDART00000041055; ENSDARP00000041054; ENSDARG00000005315 [Q9IBD0-2]
ENSDART00000134570; ENSDARP00000115192; ENSDARG00000005315 [Q9IBD0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
58137

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dre:58137

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB032726 mRNA Translation: BAA95119.1
BC049453 mRNA Translation: AAH49453.1
RefSeqiNP_001315342.1, NM_001328413.1 [Q9IBD0-2]
NP_571688.1, NM_131613.2 [Q9IBD0-1]
XP_017212394.1, XM_017356905.1

3D structure databases

SMRiQ9IBD0
ModBaseiSearch...

Protein-protein interaction databases

STRINGi7955.ENSDARP00000111278

Proteomic databases

PaxDbiQ9IBD0
PRIDEiQ9IBD0

Genome annotation databases

EnsembliENSDART00000041055; ENSDARP00000041054; ENSDARG00000005315 [Q9IBD0-2]
ENSDART00000134570; ENSDARP00000115192; ENSDARG00000005315 [Q9IBD0-1]
GeneIDi58137
KEGGidre:58137

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10658
ZFINiZDB-GENE-000501-1 celf1

Phylogenomic databases

eggNOGiKOG0144 Eukaryota
ENOG410XNTW LUCA
GeneTreeiENSGT00940000158970
HOGENOMiHOG000004754
InParanoidiQ9IBD0
KOiK13207
OMAiDHCSLNA
OrthoDBi1209165at2759
PhylomeDBiQ9IBD0

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9IBD0

Gene expression databases

BgeeiENSDARG00000005315 Expressed in 38 organ(s), highest expression level in mature ovarian follicle
ExpressionAtlasiQ9IBD0 baseline

Family and domain databases

CDDicd12631 RRM1_CELF1_2_Bruno, 1 hit
cd12634 RRM2_CELF1_2, 1 hit
cd12638 RRM3_CELF1_2, 1 hit
Gene3Di3.30.70.330, 3 hits
InterProiView protein in InterPro
IPR034196 CELF1/2_RRM1
IPR034198 CELF1/2_RRM2
IPR034199 CELF1/2_RRM3
IPR002343 Hud_Sxl_RNA
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 3 hits
PRINTSiPR00961 HUDSXLRNA
SMARTiView protein in SMART
SM00360 RRM, 3 hits
SUPFAMiSSF54928 SSF54928, 2 hits
PROSITEiView protein in PROSITE
PS50102 RRM, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCELF1_DANRE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9IBD0
Secondary accession number(s): Q7ZWE4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: October 1, 2000
Last modified: October 16, 2019
This is version 112 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again