Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 155 (07 Oct 2020)
Sequence version 4 (16 Dec 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Neurexin-3-beta

Gene

NRXN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Neuronal cell surface protein that may be involved in cell recognition and cell adhesion. May play a role in angiogenesis (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAngiogenesis, Cell adhesion

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9HDB5

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6794361, Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neurexin-3-beta
Alternative name(s):
Neurexin III-beta
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NRXN3
Synonyms:KIAA0743
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000021645.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8010, NRXN3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600567, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HDB5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini36 – 562ExtracellularSequence analysisAdd BLAST527
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei563 – 583HelicalSequence analysisAdd BLAST21
Topological domaini584 – 637CytoplasmicSequence analysisAdd BLAST54

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9369

Open Targets

More...
OpenTargetsi
ENSG00000021645

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31788

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9HDB5, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NRXN3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
218512141

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 35By similarityAdd BLAST35
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001950236 – 637Neurexin-3-betaAdd BLAST602
ChainiPRO_000041254336 – 550Neurexin-3-beta, soluble formAdd BLAST515
ChainiPRO_0000412544551 – 637Neurexin-3-beta, C-terminal fragmentAdd BLAST87

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi184N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi252N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi296N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proccessed by alpha-secretase leading to the formation of an extracellular soluble protein as well as a C-terminal membrane-embedded fragment (CTF). Proteolysis of these CTFs by gamma-secretase releases intracellular domains (ICDs) and extracellular peptides.

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HDB5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9HDB5

PeptideAtlas

More...
PeptideAtlasi
Q9HDB5

PRoteomics IDEntifications database

More...
PRIDEi
Q9HDB5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
81844 [Q9HDB5-1]
81845 [Q9HDB5-2]
81846 [Q9HDB5-3]
81847 [Q9HDB5-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HDB5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HDB5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the blood vessel walls (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000021645, Expressed in cerebellar vermis and 198 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HDB5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HDB5, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000021645, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Weakly interacts with CBLN1 and CBLN2 (By similarity). Very weak binding, if any, with CBLN4 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
114770, 18 interactors

Protein interaction database and analysis system

More...
IntActi
Q9HDB5, 9 interactors

Molecular INTeraction database

More...
MINTi
Q9HDB5

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HDB5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini85 – 255Laminin G-likePROSITE-ProRule annotationAdd BLAST171

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neurexin family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154618

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_025785_2_0_1

KEGG Orthology (KO)

More...
KOi
K07377

Database of Orthologous Groups

More...
OrthoDBi
35129at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320, ConA-like_dom_sf
IPR001791, Laminin_G
IPR003585, Neurexin-like
IPR027789, Syndecan/Neurexin_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02210, Laminin_G_2, 1 hit
PF01034, Syndecan, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00294, 4.1m, 1 hit
SM00282, LamG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899, SSF49899, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50025, LAM_G_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: A number of isoforms, alpha-type and beta-type, are produced by alternative promoter usage. Beta-type isoforms differ from alpha-type isoforms in their N-terminus. Additional isoforms produced by alternative splicing seem to exist.

This entry has 7 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1b (identifier: Q9HDB5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHLRIHARRS PPRRPAWTLG IWFLFWGCIV SSVWSSSNVA SSSSTSSSPG
60 70 80 90 100
SHSQHEHHFH GSKHHSVPIS IYRSPVSLRG GHAGATYIFG KSGGLILYTW
110 120 130 140 150
PANDRPSTRS DRLAVGFSTT VKDGILVRID SAPGLGDFLQ LHIEQGKIGV
160 170 180 190 200
VFNIGTVDIS IKEERTPVND GKYHVVRFTR NGGNATLQVD NWPVNEHYPT
210 220 230 240 250
GRQLTIFNTQ AQIAIGGKDK GRLFQGQLSG LYYDGLKVLN MAAENNPNIK
260 270 280 290 300
INGSVRLVGE VPSILGTTQT TSMPPEMSTT VMETTTTMAT TTTRKNRSTA
310 320 330 340 350
SIQPTSDDLV SSAECSSDDE DFVECEPSTG GELVIPLLVE DPLATPPIAT
360 370 380 390 400
RAPSITLPPT FRPLLTIIET TKDSLSMTSE AGLPCLSDQG SDGCDDDGLV
410 420 430 440 450
ISGYGSGETF DSNLPPTDDE DFYTTFSLVT DKSLSTSIFE GGYKAHAPKW
460 470 480 490 500
ESKDFRPNKV SETSRTTTTS LSPELIRFTA SSSSGMVPKL PAGKMNNRDL
510 520 530 540 550
KPQPDIVLLP LPTAYELDST KLKSPLITSP MFRNVPTANP TEPGIRRVPG
560 570 580 590 600
ASEVIRESSS TTGMVVGIVA AAALCILILL YAMYKYRNRD EGSYQVDETR
610 620 630
NYISNSAQSN GTLMKEKQQS SKSGHKKQKN KDREYYV
Length:637
Mass (Da):69,305
Last modified:December 16, 2008 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA0F100DA9D72A149
GO
Isoform 2b (identifier: Q9HDB5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     328-328: S → ST
     329-537: TGGELVIPLL...TSPMFRNVPT → GRS

Note: Produced by alternative splicing.Curated
Show »
Length:432
Mass (Da):47,270
Checksum:i75F3F114B012B232
GO
Isoform 3b (identifier: Q9HDB5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     329-367: TGGELVIPLL...PPTFRPLLTI → GRSARSSNAA...PIIFISCVVH
     368-637: Missing.

Note: Produced by alternative splicing.Curated
Show »
Length:396
Mass (Da):43,766
Checksum:i659003903B5F2950
GO
Isoform 4b (identifier: Q9HDB5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: T → TGNTDNERFQMVKQKIPFKYNRPVEEWLQEK
     329-536: Missing.

Note: Produced by alternative splicing.Curated
Show »
Length:459
Mass (Da):50,705
Checksum:i2717C48B9E990708
GO
Isoform 1a (identifier: Q9Y4C0-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,643
Mass (Da):180,599
GO
Isoform 3a (identifier: Q9Y4C0-3) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,061
Mass (Da):117,317
GO
Isoform 4a (identifier: Q9Y4C0-4) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q9Y4C0.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,392
Mass (Da):153,885
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RRJ0A0A0U1RRJ0_HUMAN
Neurexin-3-beta
NRXN3
1,571Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQC5A0A0U1RQC5_HUMAN
Neurexin-3-beta
NRXN3
1,664Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGK4A0A0C4DGK4_HUMAN
Neurexin-3-beta
NRXN3
398Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJL2H0YJL2_HUMAN
Neurexin-3-beta
NRXN3
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V247G3V247_HUMAN
Neurexin-3-beta
NRXN3
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MR89A0A0A0MR89_HUMAN
Neurexin-3-beta
NRXN3
879Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4R9G3V4R9_HUMAN
Neurexin-3-beta
NRXN3
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_035644200T → TGNTDNERFQMVKQKIPFKY NRPVEEWLQEK in isoform 3b and isoform 4b. 1 Publication1
Alternative sequenceiVSP_036465328S → ST in isoform 2b. 2 Publications1
Alternative sequenceiVSP_036466329 – 537TGGEL…RNVPT → GRS in isoform 2b. 2 PublicationsAdd BLAST209
Alternative sequenceiVSP_040988329 – 536Missing in isoform 4b. CuratedAdd BLAST208
Alternative sequenceiVSP_035646329 – 367TGGEL…PLLTI → GRSARSSNAARSLRAALTWT WRLTYTFTPIIFISCVVH in isoform 3b. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_035647368 – 637Missing in isoform 3b. 1 PublicationAdd BLAST270

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ493127 mRNA Translation: CAD37989.1
AF123462 Genomic DNA Translation: AAD13621.1
AK056530 mRNA Translation: BAG51739.1
AL833739 mRNA Translation: CAH56254.1
AC008056 Genomic DNA Translation: AAF09143.1
AC012099 Genomic DNA Translation: AAF15058.1
AC018514 Genomic DNA Translation: AAF99808.1
CH471061 Genomic DNA Translation: EAW81313.1
CH471061 Genomic DNA Translation: EAW81315.1
BC059368 mRNA Translation: AAH59368.1
BC068469 mRNA Translation: AAH68469.1
BC142649 mRNA Translation: AAI42650.1
BC150194 mRNA Translation: AAI50195.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45145.1 [Q9HDB5-4]
CCDS61515.1 [Q9HDB5-1]
CCDS9871.1 [Q9HDB5-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001098720.1, NM_001105250.2 [Q9HDB5-4]
NP_001258949.1, NM_001272020.1 [Q9HDB5-1]
NP_004787.2, NM_004796.5
NP_620426.2, NM_138970.4 [Q9HDB5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000281127; ENSP00000281127; ENSG00000021645 [Q9HDB5-2]
ENST00000428277; ENSP00000394426; ENSG00000021645 [Q9HDB5-4]
ENST00000557594; ENSP00000451672; ENSG00000021645 [Q9HDB5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9369

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9369

UCSC genome browser

More...
UCSCi
uc001xuq.4, human [Q9HDB5-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ493127 mRNA Translation: CAD37989.1
AF123462 Genomic DNA Translation: AAD13621.1
AK056530 mRNA Translation: BAG51739.1
AL833739 mRNA Translation: CAH56254.1
AC008056 Genomic DNA Translation: AAF09143.1
AC012099 Genomic DNA Translation: AAF15058.1
AC018514 Genomic DNA Translation: AAF99808.1
CH471061 Genomic DNA Translation: EAW81313.1
CH471061 Genomic DNA Translation: EAW81315.1
BC059368 mRNA Translation: AAH59368.1
BC068469 mRNA Translation: AAH68469.1
BC142649 mRNA Translation: AAI42650.1
BC150194 mRNA Translation: AAI50195.1
CCDSiCCDS45145.1 [Q9HDB5-4]
CCDS61515.1 [Q9HDB5-1]
CCDS9871.1 [Q9HDB5-2]
RefSeqiNP_001098720.1, NM_001105250.2 [Q9HDB5-4]
NP_001258949.1, NM_001272020.1 [Q9HDB5-1]
NP_004787.2, NM_004796.5
NP_620426.2, NM_138970.4 [Q9HDB5-2]

3D structure databases

SMRiQ9HDB5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114770, 18 interactors
IntActiQ9HDB5, 9 interactors
MINTiQ9HDB5

PTM databases

iPTMnetiQ9HDB5
PhosphoSitePlusiQ9HDB5

Polymorphism and mutation databases

BioMutaiNRXN3
DMDMi218512141

Proteomic databases

EPDiQ9HDB5
MassIVEiQ9HDB5
PeptideAtlasiQ9HDB5
PRIDEiQ9HDB5
ProteomicsDBi81844 [Q9HDB5-1]
81845 [Q9HDB5-2]
81846 [Q9HDB5-3]
81847 [Q9HDB5-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
106, 231 antibodies

Genome annotation databases

EnsembliENST00000281127; ENSP00000281127; ENSG00000021645 [Q9HDB5-2]
ENST00000428277; ENSP00000394426; ENSG00000021645 [Q9HDB5-4]
ENST00000557594; ENSP00000451672; ENSG00000021645 [Q9HDB5-1]
GeneIDi9369
KEGGihsa:9369
UCSCiuc001xuq.4, human [Q9HDB5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9369
DisGeNETi9369
EuPathDBiHostDB:ENSG00000021645.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NRXN3
HGNCiHGNC:8010, NRXN3
HPAiENSG00000021645, Tissue enhanced (brain)
MIMi600567, gene
neXtProtiNX_Q9HDB5
OpenTargetsiENSG00000021645
PharmGKBiPA31788

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000154618
HOGENOMiCLU_025785_2_0_1
KOiK07377
OrthoDBi35129at2759

Enzyme and pathway databases

PathwayCommonsiQ9HDB5
ReactomeiR-HSA-6794361, Neurexins and neuroligins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9369, 2 hits in 867 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NRXN3, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NRXN3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9369
PharosiQ9HDB5, Tbio

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000021645, Expressed in cerebellar vermis and 198 other tissues
ExpressionAtlasiQ9HDB5, baseline and differential
GenevisibleiQ9HDB5, HS

Family and domain databases

InterProiView protein in InterPro
IPR013320, ConA-like_dom_sf
IPR001791, Laminin_G
IPR003585, Neurexin-like
IPR027789, Syndecan/Neurexin_dom
PfamiView protein in Pfam
PF02210, Laminin_G_2, 1 hit
PF01034, Syndecan, 1 hit
SMARTiView protein in SMART
SM00294, 4.1m, 1 hit
SM00282, LamG, 1 hit
SUPFAMiSSF49899, SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS50025, LAM_G_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRX3B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HDB5
Secondary accession number(s): A5PKW8
, A8MPU5, B3KPM7, Q6NUR0, Q8IUD8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: December 16, 2008
Last modified: October 7, 2020
This is version 155 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again