Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 154 (11 Dec 2019)
Sequence version 2 (29 Mar 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

O-phosphoseryl-tRNA(Sec) selenium transferase

Gene

SEPSECS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Converts O-phosphoseryl-tRNA(Sec) to selenocysteinyl-tRNA(Sec) required for selenoprotein biosynthesis.1 Publication

Miscellaneous

Possible diagnostic marker for autoimmune hepatitis (AIH).

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

pyridoxal 5'-phosphate2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: selenocysteinyl-tRNA(Sec) biosynthesis

This protein is involved in step 2 of the subpathway that synthesizes selenocysteinyl-tRNA(Sec) from L-seryl-tRNA(Sec) (archaeal/eukaryal route).1 Publication
Proteins known to be involved in the 2 steps of the subpathway in this organism are:
  1. L-seryl-tRNA(Sec) kinase (PSTK)
  2. O-phosphoseryl-tRNA(Sec) selenium transferase (SEPSECS), O-phosphoseryl-tRNA(Sec) selenium transferase, O-phosphoseryl-tRNA(Sec) selenium transferase (SEPSECS)
This subpathway is part of the pathway selenocysteinyl-tRNA(Sec) biosynthesis, which is itself part of Aminoacyl-tRNA biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes selenocysteinyl-tRNA(Sec) from L-seryl-tRNA(Sec) (archaeal/eukaryal route), the pathway selenocysteinyl-tRNA(Sec) biosynthesis and in Aminoacyl-tRNA biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei74May act as a substrate filter by repelling compounds with a negatively charged alpha-carboxylateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei75Pyridoxal phosphate1 Publication1
Binding sitei97Substrate1 Publication1
Binding sitei98Substrate1 Publication1
Binding sitei105Substrate1 Publication1
Binding sitei271tRNA variable arm1 Publication1
Binding sitei313Substrate1 Publication1
Binding sitei398tRNA discriminator base1 Publication1
Binding sitei463tRNA acceptor arm1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding, Transferase, tRNA-binding
Biological processProtein biosynthesis
LigandPyridoxal phosphate, Selenium

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.9.1.2 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2408557 Selenocysteine synthesis

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00906;UER00898

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
O-phosphoseryl-tRNA(Sec) selenium transferase (EC:2.9.1.21 Publication)
Alternative name(s):
Liver-pancreas antigen
Short name:
LP
SLA-p35
SLA/LP autoantigen
Selenocysteine synthase
Short name:
Sec synthase
Selenocysteinyl-tRNA(Sec) synthase
Sep-tRNA:Sec-tRNA synthase
Short name:
SepSecS
Soluble liver antigen
Short name:
SLA
UGA suppressor tRNA-associated protein
tRNA(Ser/Sec)-associated antigenic protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEPSECS
Synonyms:TRNP48
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000109618.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30605 SEPSECS

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613009 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HD40

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pontocerebellar hypoplasia 2D (PCH2D)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by postnatal onset of progressive atrophy of the cerebrum and cerebellum, microcephaly, profound mental retardation, spasticity, and variable seizures.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_065585239A → T in PCH2D; abrogates enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs267607035EnsemblClinVar.1
Natural variantiVAR_074163325T → S in PCH2D. 1 PublicationCorresponds to variant dbSNP:rs1461368206Ensembl.1
Natural variantiVAR_065586334Y → C in PCH2D; abrogates enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs267607036EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi75R → A: Inactive in vivo. 1 Publication1
Mutagenesisi97R → A: Indistinguishable from wild-type. 1 Publication1
Mutagenesisi97R → Q: Indistinguishable from wild-type. 1 Publication1
Mutagenesisi105Q → A: Inactive in vivo. 1 Publication1
Mutagenesisi173K → A: Indistinguishable from wild-type. 1 Publication1
Mutagenesisi173K → M: Indistinguishable from wild-type. 1 Publication1
Mutagenesisi284K → A: Loss of activity. 1 Publication1
Mutagenesisi313R → A: Inactive in vivo. 1 Publication1

Keywords - Diseasei

Disease mutation, Epilepsy, Mental retardation, Neurodegeneration

Organism-specific databases

DisGeNET

More...
DisGeNETi
51091

MalaCards human disease database

More...
MalaCardsi
SEPSECS
MIMi613811 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000109618

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2524 Pontocerebellar hypoplasia type 2
247198 Progressive cerebello-cerebral atrophy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162402915

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9HD40 Tbio

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB00114 Pyridoxal phosphate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SEPSECS

Domain mapping of disease mutations (DMDM)

More...
DMDMi
62287911

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002198751 – 501O-phosphoseryl-tRNA(Sec) selenium transferaseAdd BLAST501

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei14PhosphoserineCombined sources1
Modified residuei284N6-(pyridoxal phosphate)lysine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HD40

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9HD40

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9HD40

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HD40

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HD40

PeptideAtlas

More...
PeptideAtlasi
Q9HD40

PRoteomics IDEntifications database

More...
PRIDEi
Q9HD40

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
81825 [Q9HD40-1]
81826 [Q9HD40-2]
81827 [Q9HD40-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HD40

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HD40

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Primarily expressed in liver, pancreas, kidney and lung. Overexpressed in PHA-stimulated T-cells.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000109618 Expressed in 168 organ(s), highest expression level in right lobe of liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HD40 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HD40 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA070409

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer formed by a catalytic dimer and a non-catalytic dimer serving as a binding platform that orients tRNASec for catalysis. Each tetramer binds the CCA ends of two tRNAs which point to the active sites of the catalytic dimer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P045913EBI-6163446,EBI-6163428From Human immunodeficiency virus type 1 group M subtype B (isolate HXB2).

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119280, 11 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9HD40

Protein interaction database and analysis system

More...
IntActi
Q9HD40, 10 interactors

Molecular INTeraction database

More...
MINTi
Q9HD40

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000371535

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9HD40 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1501
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HD40

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9HD40

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 44Tetramerization1 PublicationAdd BLAST44
Regioni96 – 106Phosphate loop (P-loop)1 PublicationAdd BLAST11
Regioni474 – 493SLA/LP epitope1 PublicationAdd BLAST20

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SepSecS family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3843 Eukaryota
COG0076 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007332

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000254245

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HD40

KEGG Orthology (KO)

More...
KOi
K03341

Identification of Orthologs from Complete Genome Data

More...
OMAi
AENILCV

Database of Orthologous Groups

More...
OrthoDBi
680116at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HD40

TreeFam database of animal gene trees

More...
TreeFami
TF314381

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.640.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019793 Peroxidases_heam-ligand_BS
IPR015424 PyrdxlP-dep_Trfase
IPR015421 PyrdxlP-dep_Trfase_major
IPR019872 Sec-tRNA_Se_transferase
IPR008829 SepSecS/SepCysS

The PANTHER Classification System

More...
PANTHERi
PTHR12944 PTHR12944, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05889 SepSecS, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF017689 SepSecS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53383 SSF53383, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR03531 selenium_SpcS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HD40-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRESFAAGE RLVSPAYVRQ GCEARRSHEH LIRLLLEKGK CPENGWDEST
60 70 80 90 100
LELFLHELAI MDSNNFLGNC GVGEREGRVA SALVARRHYR FIHGIGRSGD
110 120 130 140 150
ISAVQPKAAG SSLLNKITNS LVLDIIKLAG VHTVANCFVV PMATGMSLTL
160 170 180 190 200
CFLTLRHKRP KAKYIIWPRI DQKSCFKSMI TAGFEPVVIE NVLEGDELRT
210 220 230 240 250
DLKAVEAKVQ ELGPDCILCI HSTTSCFAPR VPDRLEELAV ICANYDIPHI
260 270 280 290 300
VNNAYGVQSS KCMHLIQQGA RVGRIDAFVQ SLDKNFMVPV GGAIIAGFND
310 320 330 340 350
SFIQEISKMY PGRASASPSL DVLITLLSLG SNGYKKLLKE RKEMFSYLSN
360 370 380 390 400
QIKKLSEAYN ERLLHTPHNP ISLAMTLKTL DEHRDKAVTQ LGSMLFTRQV
410 420 430 440 450
SGARVVPLGS MQTVSGYTFR GFMSHTNNYP CAYLNAASAI GMKMQDVDLF
460 470 480 490 500
IKRLDRCLKA VRKERSKESD DNYDKTEDVD IEEMALKLDN VLLDTYQDAS

S
Length:501
Mass (Da):55,726
Last modified:March 29, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7136FB390B18760B
GO
Isoform 2 (identifier: Q9HD40-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-47: GKCPENGWD → VHSWHWTIR
     48-501: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:47
Mass (Da):5,627
Checksum:i958F3F91D272149B
GO
Isoform 3 (identifier: Q9HD40-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MNRESFAAGERLVSPAYVRQGCEARRSHEHLIRLLLEK → MQCDDLGSLQPPPPGFTPFACLSLPSSWDYRRPPPHP

Show »
Length:500
Mass (Da):55,411
Checksum:i82AE23050D9C2011
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y9D2H0Y9D2_HUMAN
O-phosphoseryl-tRNA(Sec) selenium t...
SEPSECS
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R969D6R969_HUMAN
O-phosphoseryl-tRNA(Sec) selenium t...
SEPSECS
177Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KP25J3KP25_HUMAN
O-phosphoseryl-tRNA(Sec) selenium t...
SEPSECS
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD33963 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence AAH23539 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence CAB62209 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence CAB89517 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti98S → P in AAG00491 (Ref. 8) Curated1
Sequence conflicti264H → R in BAF85165 (PubMed:14702039).Curated1
Sequence conflicti398R → K in AAD33963 (PubMed:10801173).Curated1
Sequence conflicti398R → K in CAB89517 (PubMed:10801173).Curated1
Sequence conflicti452K → N in AAD33963 (PubMed:10801173).Curated1
Sequence conflicti452K → N in CAB89517 (PubMed:10801173).Curated1
Sequence conflicti467K → R in AAG00491 (Ref. 8) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_065585239A → T in PCH2D; abrogates enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs267607035EnsemblClinVar.1
Natural variantiVAR_074163325T → S in PCH2D. 1 PublicationCorresponds to variant dbSNP:rs1461368206Ensembl.1
Natural variantiVAR_065586334Y → C in PCH2D; abrogates enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs267607036EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0380801 – 38MNRES…LLLEK → MQCDDLGSLQPPPPGFTPFA CLSLPSSWDYRRPPPHP in isoform 3. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_03807839 – 47GKCPENGWD → VHSWHWTIR in isoform 2. 2 Publications9
Alternative sequenceiVSP_03807948 – 501Missing in isoform 2. 2 PublicationsAdd BLAST454

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK292476 mRNA Translation: BAF85165.1
BX648976 mRNA No translation available.
AC007073 Genomic DNA No translation available.
AC104662 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW92832.1
BC023539 mRNA Translation: AAH23539.1 Sequence problems.
BC117202 mRNA Translation: AAI17203.1
AF146396 mRNA Translation: AAD33963.2 Sequence problems.
AJ277541 mRNA Translation: CAB89517.1 Frameshift.
AJ238617 mRNA Translation: CAB62209.1 Different initiation.
AF282065 mRNA Translation: AAG00491.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3432.2 [Q9HD40-1]

NCBI Reference Sequences

More...
RefSeqi
NP_058651.3, NM_016955.3 [Q9HD40-1]
XP_011512148.1, XM_011513846.2 [Q9HD40-3]
XP_011512150.1, XM_011513848.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000382103; ENSP00000371535; ENSG00000109618 [Q9HD40-1]
ENST00000514585; ENSP00000421880; ENSG00000109618 [Q9HD40-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51091

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51091

UCSC genome browser

More...
UCSCi
uc003grg.4 human [Q9HD40-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK292476 mRNA Translation: BAF85165.1
BX648976 mRNA No translation available.
AC007073 Genomic DNA No translation available.
AC104662 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW92832.1
BC023539 mRNA Translation: AAH23539.1 Sequence problems.
BC117202 mRNA Translation: AAI17203.1
AF146396 mRNA Translation: AAD33963.2 Sequence problems.
AJ277541 mRNA Translation: CAB89517.1 Frameshift.
AJ238617 mRNA Translation: CAB62209.1 Different initiation.
AF282065 mRNA Translation: AAG00491.1
CCDSiCCDS3432.2 [Q9HD40-1]
RefSeqiNP_058651.3, NM_016955.3 [Q9HD40-1]
XP_011512148.1, XM_011513846.2 [Q9HD40-3]
XP_011512150.1, XM_011513848.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3HL2X-ray2.81A/B/C/D1-501[»]
4ZDLX-ray2.26A/B1-501[»]
4ZDOX-ray2.65A/B/C/D1-501[»]
4ZDPX-ray2.70A/B/C/D1-501[»]
SMRiQ9HD40
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi119280, 11 interactors
CORUMiQ9HD40
IntActiQ9HD40, 10 interactors
MINTiQ9HD40
STRINGi9606.ENSP00000371535

Chemistry databases

DrugBankiDB00114 Pyridoxal phosphate

PTM databases

iPTMnetiQ9HD40
PhosphoSitePlusiQ9HD40

Polymorphism and mutation databases

BioMutaiSEPSECS
DMDMi62287911

Proteomic databases

EPDiQ9HD40
jPOSTiQ9HD40
MassIVEiQ9HD40
MaxQBiQ9HD40
PaxDbiQ9HD40
PeptideAtlasiQ9HD40
PRIDEiQ9HD40
ProteomicsDBi81825 [Q9HD40-1]
81826 [Q9HD40-2]
81827 [Q9HD40-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51091

Genome annotation databases

EnsembliENST00000382103; ENSP00000371535; ENSG00000109618 [Q9HD40-1]
ENST00000514585; ENSP00000421880; ENSG00000109618 [Q9HD40-2]
GeneIDi51091
KEGGihsa:51091
UCSCiuc003grg.4 human [Q9HD40-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51091
DisGeNETi51091
EuPathDBiHostDB:ENSG00000109618.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SEPSECS
HGNCiHGNC:30605 SEPSECS
HPAiHPA070409
MalaCardsiSEPSECS
MIMi613009 gene
613811 phenotype
neXtProtiNX_Q9HD40
OpenTargetsiENSG00000109618
Orphaneti2524 Pontocerebellar hypoplasia type 2
247198 Progressive cerebello-cerebral atrophy
PharmGKBiPA162402915

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3843 Eukaryota
COG0076 LUCA
GeneTreeiENSGT00390000007332
HOGENOMiHOG000254245
InParanoidiQ9HD40
KOiK03341
OMAiAENILCV
OrthoDBi680116at2759
PhylomeDBiQ9HD40
TreeFamiTF314381

Enzyme and pathway databases

UniPathwayiUPA00906;UER00898
BRENDAi2.9.1.2 2681
ReactomeiR-HSA-2408557 Selenocysteine synthesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SEPSECS human
EvolutionaryTraceiQ9HD40

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SEPSECS

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51091
PharosiQ9HD40 Tbio

Protein Ontology

More...
PROi
PR:Q9HD40
RNActiQ9HD40 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000109618 Expressed in 168 organ(s), highest expression level in right lobe of liver
ExpressionAtlasiQ9HD40 baseline and differential
GenevisibleiQ9HD40 HS

Family and domain databases

Gene3Di3.40.640.10, 1 hit
InterProiView protein in InterPro
IPR019793 Peroxidases_heam-ligand_BS
IPR015424 PyrdxlP-dep_Trfase
IPR015421 PyrdxlP-dep_Trfase_major
IPR019872 Sec-tRNA_Se_transferase
IPR008829 SepSecS/SepCysS
PANTHERiPTHR12944 PTHR12944, 1 hit
PfamiView protein in Pfam
PF05889 SepSecS, 1 hit
PIRSFiPIRSF017689 SepSecS, 1 hit
SUPFAMiSSF53383 SSF53383, 1 hit
TIGRFAMsiTIGR03531 selenium_SpcS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPCS_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HD40
Secondary accession number(s): A8K8W1
, Q0D2P3, Q17RT1, Q9NXZ5, Q9UGM9, Q9Y353
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: March 29, 2005
Last modified: December 11, 2019
This is version 154 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again