Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 152 (18 Sep 2019)
Sequence version 4 (13 Jun 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Plexin-A4

Gene

PLXNA4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-399954 Sema3A PAK dependent Axon repulsion
R-HSA-399955 SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
R-HSA-399956 CRMPs in Sema3A signaling
R-HSA-416700 Other semaphorin interactions
R-HSA-9615017 FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Plexin-A4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLXNA4
Synonyms:KIAA1550, PLXNA4A, PLXNA4B
ORF Names:UNQ2820/PRO34003
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9102 PLXNA4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604280 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HCM2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 1237ExtracellularSequence analysisAdd BLAST1214
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1238 – 1258HelicalSequence analysisAdd BLAST21
Topological domaini1259 – 1894CytoplasmicSequence analysisAdd BLAST636

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
91584

Open Targets

More...
OpenTargetsi
ENSG00000221866

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162399757
PA33428

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLXNA4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
108860890

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024028324 – 1894Plexin-A4Add BLAST1871

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi95 ↔ 104PROSITE-ProRule annotation
Disulfide bondi130 ↔ 138PROSITE-ProRule annotation
Disulfide bondi284 ↔ 405PROSITE-ProRule annotation
Disulfide bondi300 ↔ 356PROSITE-ProRule annotation
Disulfide bondi374 ↔ 393PROSITE-ProRule annotation
Disulfide bondi510 ↔ 527PROSITE-ProRule annotation
Disulfide bondi516 ↔ 558PROSITE-ProRule annotation
Disulfide bondi519 ↔ 536PROSITE-ProRule annotation
Disulfide bondi530 ↔ 542PROSITE-ProRule annotation
Disulfide bondi593 ↔ 612PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi655N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1007N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1132N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1180N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1350N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HCM2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9HCM2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9HCM2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HCM2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HCM2

PeptideAtlas

More...
PeptideAtlasi
Q9HCM2

PRoteomics IDEntifications database

More...
PRIDEi
Q9HCM2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
623
81755 [Q9HCM2-1]
81756 [Q9HCM2-2]
81757 [Q9HCM2-3]
81758 [Q9HCM2-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HCM2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HCM2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9HCM2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000221866 Expressed in 174 organ(s), highest expression level in brain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HCM2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HCM2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029919
HPA052141
HPA075592

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NRP1 and NRP2.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124849, 7 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9HCM2

Protein interaction database and analysis system

More...
IntActi
Q9HCM2, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000352882

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11894
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HCM2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini24 – 507SemaPROSITE-ProRule annotationAdd BLAST484
Domaini509 – 559PSI 1Add BLAST51
Domaini655 – 702PSI 2Add BLAST48
Domaini803 – 856PSI 3Add BLAST54
Domaini858 – 952IPT/TIG 1Add BLAST95
Domaini954 – 1037IPT/TIG 2Add BLAST84
Domaini1040 – 1139IPT/TIG 3Add BLAST100
Domaini1142 – 1230IPT/TIG 4Add BLAST89

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the plexin family.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3610 Eukaryota
ENOG410XR88 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182738

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000252970

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HCM2

KEGG Orthology (KO)

More...
KOi
K06820

Identification of Orthologs from Complete Genome Data

More...
OMAi
HPNNISV

Database of Orthologous Groups

More...
OrthoDBi
503281at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HCM2

TreeFam database of animal gene trees

More...
TreeFami
TF312962

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit
2.60.40.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR041019 TIG1_plexin
IPR041362 TIG2_plexin
IPR015943 WD40/YVTN_repeat-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR22625 PTHR22625, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 2 hits
PF01403 Sema, 1 hit
PF01833 TIG, 4 hits
PF18020 TIG_2, 1 hit
PF17960 TIG_plexin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00429 IPT, 4 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 1 hit
SSF81296 SSF81296, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51004 SEMA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9HCM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKAMPWNWTC LLSHLLMVGM GSSTLLTRQP APLSQKQRSF VTFRGEPAEG
60 70 80 90 100
FNHLVVDERT GHIYLGAVNR IYKLSSDLKV LVTHETGPDE DNPKCYPPRI
110 120 130 140 150
VQTCNEPLTT TNNVNKMLLI DYKENRLIAC GSLYQGICKL LRLEDLFKLG
160 170 180 190 200
EPYHKKEHYL SGVNESGSVF GVIVSYSNLD DKLFIATAVD GKPEYFPTIS
210 220 230 240 250
SRKLTKNSEA DGMFAYVFHD EFVASMIKIP SDTFTIIPDF DIYYVYGFSS
260 270 280 290 300
GNFVYFLTLQ PEMVSPPGST TKEQVYTSKL VRLCKEDTAF NSYVEVPIGC
310 320 330 340 350
ERSGVEYRLL QAAYLSKAGA VLGRTLGVHP DDDLLFTVFS KGQKRKMKSL
360 370 380 390 400
DESALCIFIL KQINDRIKER LQSCYRGEGT LDLAWLKVKD IPCSSALLTI
410 420 430 440 450
DDNFCGLDMN APLGVSDMVR GIPVFTEDRD RMTSVIAYVY KNHSLAFVGT
460 470 480 490 500
KSGKLKKIRV DGPRGNALQY ETVQVVDPGP VLRDMAFSKD HEQLYIMSER
510 520 530 540 550
QLTRVPVESC GQYQSCGECL GSGDPHCGWC VLHNTCTRKE RCERSKEPRR
560 570 580 590 600
FASEMKQCVR LTVHPNNISV SQYNVLLVLE TYNVPELSAG VNCTFEDLSE
610 620 630 640 650
MDGLVVGNQI QCYSPAAKEV PRIITENGDH HVVQLQLKSK ETGMTFASTS
660 670 680 690 700
FVFYNCSVHN SCLSCVESPY RCHWCKYRHV CTHDPKTCSF QEGRVKLPED
710 720 730 740 750
CPQLLRVDKI LVPVEVIKPI TLKAKNLPQP QSGQRGYECI LNIQGSEQRV
760 770 780 790 800
PALRFNSSSV QCQNTSYSYE GMEINNLPVE LTVVWNGHFN IDNPAQNKVH
810 820 830 840 850
LYKCGAMRES CGLCLKADPD FACGWCQGPG QCTLRQHCPA QESQWLELSG
860 870 880 890 900
AKSKCTNPRI TEIIPVTGPR EGGTKVTIRG ENLGLEFRDI ASHVKVAGVE
910 920 930 940 950
CSPLVDGYIP AEQIVCEMGE AKPSQHAGFV EICVAVCRPE FMARSSQLYY
960 970 980 990 1000
FMTLTLSDLK PSRGPMSGGT QVTITGTNLN AGSNVVVMFG KQPCLFHRRS
1010 1020 1030 1040 1050
PSYIVCNTTS SDEVLEMKVS VQVDRAKIHQ DLVFQYVEDP TIVRIEPEWS
1060 1070 1080 1090 1100
IVSGNTPIAV WGTHLDLIQN PQIRAKHGGK EHINICEVLN ATEMTCQAPA
1110 1120 1130 1140 1150
LALGPDHQSD LTERPEEFGF ILDNVQSLLI LNKTNFTYYP NPVFEAFGPS
1160 1170 1180 1190 1200
GILELKPGTP IILKGKNLIP PVAGGNVKLN YTVLVGEKPC TVTVSDVQLL
1210 1220 1230 1240 1250
CESPNLIGRH KVMARVGGME YSPGMVYIAP DSPLSLPAIV SIAVAGGLLI
1260 1270 1280 1290 1300
IFIVAVLIAY KRKSRESDLT LKRLQMQMDN LESRVALECK EAFAELQTDI
1310 1320 1330 1340 1350
HELTSDLDGA GIPFLDYRTY TMRVLFPGIE DHPVLRDLEV PGYRQERVEK
1360 1370 1380 1390 1400
GLKLFAQLIN NKVFLLSFIR TLESQRSFSM RDRGNVASLI MTVLQSKLEY
1410 1420 1430 1440 1450
ATDVLKQLLA DLIDKNLESK NHPKLLLRRT ESVAEKMLTN WFTFLLYKFL
1460 1470 1480 1490 1500
KECAGEPLFS LFCAIKQQME KGPIDAITGE ARYSLSEDKL IRQQIDYKTL
1510 1520 1530 1540 1550
VLSCVSPDNA NSPEVPVKIL NCDTITQVKE KILDAIFKNV PCSHRPKAAD
1560 1570 1580 1590 1600
MDLEWRQGSG ARMILQDEDI TTKIENDWKR LNTLAHYQVP DGSVVALVSK
1610 1620 1630 1640 1650
QVTAYNAVNN STVSRTSASK YENMIRYTGS PDSLRSRTPM ITPDLESGVK
1660 1670 1680 1690 1700
MWHLVKNHEH GDQKEGDRGS KMVSEIYLTR LLATKGTLQK FVDDLFETIF
1710 1720 1730 1740 1750
STAHRGSALP LAIKYMFDFL DEQADKHGIH DPHVRHTWKS NCLPLRFWVN
1760 1770 1780 1790 1800
MIKNPQFVFD IHKNSITDAC LSVVAQTFMD SCSTSEHRLG KDSPSNKLLY
1810 1820 1830 1840 1850
AKDIPSYKNW VERYYSDIGK MPAISDQDMN AYLAEQSRMH MNEFNTMSAL
1860 1870 1880 1890
SEIFSYVGKY SEEILGPLDH DDQCGKQKLA YKLEQVITLM SLDS
Length:1,894
Mass (Da):212,455
Last modified:June 13, 2006 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B45C8929C5847DF
GO
Isoform 2 (identifier: Q9HCM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-492: IRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHE → MPGTSLCPTLELQTGPRSHRATVTLELLFSSCSSN
     493-1894: Missing.

Show »
Length:492
Mass (Da):55,034
Checksum:iEA48649E41364BCA
GO
Isoform 3 (identifier: Q9HCM2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     458-522: IRVDGPRGNA...YQSCGECLGS → SFGTGPQGGI...CFLNVPGNSS
     523-1894: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:522
Mass (Da):58,165
Checksum:iDF8322647088FE4B
GO
Isoform 4 (identifier: Q9HCM2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1550: Missing.

Show »
Length:344
Mass (Da):39,312
Checksum:i500F224FA6A400E8
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ89209 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1750N → D in CAD39161 (PubMed:17974005).Curated1
Sequence conflicti1804I → V in CAD39161 (PubMed:17974005).Curated1
Isoform 2 (identifier: Q9HCM2-2)
Sequence conflicti458M → V in BAC85615 (PubMed:14702039).Curated1
Sequence conflicti458M → V in AAQ89209 (PubMed:12975309).Curated1
Isoform 3 (identifier: Q9HCM2-3)
Sequence conflicti475E → A in AAH28744 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0193341 – 1550Missing in isoform 4. 1 PublicationAdd BLAST1550
Alternative sequenceiVSP_019330458 – 522IRVDG…ECLGS → SFGTGPQGGITQEWIGVEGD PPGANIASQEQMLCVYLQCS SHKAISDQRVQPLLCCFLNV PGNSS in isoform 3. 2 PublicationsAdd BLAST65
Alternative sequenceiVSP_019331458 – 492IRVDG…SKDHE → MPGTSLCPTLELQTGPRSHR ATVTLELLFSSCSSN in isoform 2. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_019332493 – 1894Missing in isoform 2. 2 PublicationsAdd BLAST1402
Alternative sequenceiVSP_019333523 – 1894Missing in isoform 3. 2 PublicationsAdd BLAST1372

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK095606 mRNA Translation: BAC04587.1
AK123428 mRNA Translation: BAC85615.1
AC009364 Genomic DNA No translation available.
AC009365 Genomic DNA No translation available.
AC009785 Genomic DNA No translation available.
AC011625 Genomic DNA No translation available.
AC018643 Genomic DNA No translation available.
AC026239 Genomic DNA No translation available.
CH236950 Genomic DNA Translation: EAL24076.1
CH471070 Genomic DNA Translation: EAW83793.1
BC028744 mRNA Translation: AAH28744.1
AY358850 mRNA Translation: AAQ89209.1 Different initiation.
AL137352 mRNA Translation: CAB70707.1
AL834504 mRNA Translation: CAD39161.3
AB046770 mRNA Translation: BAB13376.3

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43646.1 [Q9HCM2-1]
CCDS43647.1 [Q9HCM2-2]
CCDS5826.1 [Q9HCM2-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46426

NCBI Reference Sequences

More...
RefSeqi
NP_001099013.1, NM_001105543.1 [Q9HCM2-2]
NP_065962.1, NM_020911.1 [Q9HCM2-1]
NP_861440.2, NM_181775.3 [Q9HCM2-3]
XP_005250743.1, XM_005250686.4 [Q9HCM2-1]
XP_006716234.1, XM_006716171.3 [Q9HCM2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000321063; ENSP00000323194; ENSG00000221866 [Q9HCM2-1]
ENST00000359827; ENSP00000352882; ENSG00000221866 [Q9HCM2-1]
ENST00000378539; ENSP00000367800; ENSG00000221866 [Q9HCM2-3]
ENST00000423507; ENSP00000392772; ENSG00000221866 [Q9HCM2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
91584

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:91584

UCSC genome browser

More...
UCSCi
uc003vra.4 human [Q9HCM2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK095606 mRNA Translation: BAC04587.1
AK123428 mRNA Translation: BAC85615.1
AC009364 Genomic DNA No translation available.
AC009365 Genomic DNA No translation available.
AC009785 Genomic DNA No translation available.
AC011625 Genomic DNA No translation available.
AC018643 Genomic DNA No translation available.
AC026239 Genomic DNA No translation available.
CH236950 Genomic DNA Translation: EAL24076.1
CH471070 Genomic DNA Translation: EAW83793.1
BC028744 mRNA Translation: AAH28744.1
AY358850 mRNA Translation: AAQ89209.1 Different initiation.
AL137352 mRNA Translation: CAB70707.1
AL834504 mRNA Translation: CAD39161.3
AB046770 mRNA Translation: BAB13376.3
CCDSiCCDS43646.1 [Q9HCM2-1]
CCDS43647.1 [Q9HCM2-2]
CCDS5826.1 [Q9HCM2-3]
PIRiT46426
RefSeqiNP_001099013.1, NM_001105543.1 [Q9HCM2-2]
NP_065962.1, NM_020911.1 [Q9HCM2-1]
NP_861440.2, NM_181775.3 [Q9HCM2-3]
XP_005250743.1, XM_005250686.4 [Q9HCM2-1]
XP_006716234.1, XM_006716171.3 [Q9HCM2-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4E74X-ray1.58A1488-1603[»]
SMRiQ9HCM2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi124849, 7 interactors
CORUMiQ9HCM2
IntActiQ9HCM2, 3 interactors
STRINGi9606.ENSP00000352882

PTM databases

iPTMnetiQ9HCM2
PhosphoSitePlusiQ9HCM2
SwissPalmiQ9HCM2

Polymorphism and mutation databases

BioMutaiPLXNA4
DMDMi108860890

Proteomic databases

EPDiQ9HCM2
jPOSTiQ9HCM2
MassIVEiQ9HCM2
MaxQBiQ9HCM2
PaxDbiQ9HCM2
PeptideAtlasiQ9HCM2
PRIDEiQ9HCM2
ProteomicsDBi623
81755 [Q9HCM2-1]
81756 [Q9HCM2-2]
81757 [Q9HCM2-3]
81758 [Q9HCM2-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
91584
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321063; ENSP00000323194; ENSG00000221866 [Q9HCM2-1]
ENST00000359827; ENSP00000352882; ENSG00000221866 [Q9HCM2-1]
ENST00000378539; ENSP00000367800; ENSG00000221866 [Q9HCM2-3]
ENST00000423507; ENSP00000392772; ENSG00000221866 [Q9HCM2-2]
GeneIDi91584
KEGGihsa:91584
UCSCiuc003vra.4 human [Q9HCM2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
91584
DisGeNETi91584

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLXNA4
HGNCiHGNC:9102 PLXNA4
HPAiHPA029919
HPA052141
HPA075592
MIMi604280 gene
neXtProtiNX_Q9HCM2
OpenTargetsiENSG00000221866
PharmGKBiPA162399757
PA33428

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3610 Eukaryota
ENOG410XR88 LUCA
GeneTreeiENSGT00950000182738
HOGENOMiHOG000252970
InParanoidiQ9HCM2
KOiK06820
OMAiHPNNISV
OrthoDBi503281at2759
PhylomeDBiQ9HCM2
TreeFamiTF312962

Enzyme and pathway databases

ReactomeiR-HSA-399954 Sema3A PAK dependent Axon repulsion
R-HSA-399955 SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion
R-HSA-399956 CRMPs in Sema3A signaling
R-HSA-416700 Other semaphorin interactions
R-HSA-9615017 FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLXNA4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PLXNA4A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
91584

Pharos

More...
Pharosi
Q9HCM2

Protein Ontology

More...
PROi
PR:Q9HCM2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000221866 Expressed in 174 organ(s), highest expression level in brain
ExpressionAtlasiQ9HCM2 baseline and differential
GenevisibleiQ9HCM2 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.60.40.10, 4 hits
InterProiView protein in InterPro
IPR013783 Ig-like_fold
IPR014756 Ig_E-set
IPR002909 IPT_dom
IPR031148 Plexin
IPR013548 Plexin_cytoplasmic_RasGAP_dom
IPR002165 Plexin_repeat
IPR016201 PSI
IPR008936 Rho_GTPase_activation_prot
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR041019 TIG1_plexin
IPR041362 TIG2_plexin
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR22625 PTHR22625, 1 hit
PfamiView protein in Pfam
PF08337 Plexin_cytopl, 1 hit
PF01437 PSI, 2 hits
PF01403 Sema, 1 hit
PF01833 TIG, 4 hits
PF18020 TIG_2, 1 hit
PF17960 TIG_plexin, 1 hit
SMARTiView protein in SMART
SM00429 IPT, 4 hits
SM00423 PSI, 3 hits
SM00630 Sema, 1 hit
SUPFAMiSSF101912 SSF101912, 1 hit
SSF48350 SSF48350, 1 hit
SSF81296 SSF81296, 4 hits
PROSITEiView protein in PROSITE
PS51004 SEMA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLXA4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HCM2
Secondary accession number(s): A4D1N6
, E9PAM2, Q6UWC6, Q6ZW89, Q8N969, Q8ND00, Q8NEN3, Q9NTD4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: June 13, 2006
Last modified: September 18, 2019
This is version 152 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again