Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 171 (13 Feb 2019)
Sequence version 2 (21 Jun 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Roundabout homolog 2

Gene

ROBO2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processChemotaxis, Differentiation, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-376176 Signaling by ROBO receptors
R-HSA-428542 Regulation of commissural axon pathfinding by SLIT and ROBO
R-HSA-8985801 Regulation of cortical dendrite branching
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-9010642 ROBO receptors bind AKAP5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Roundabout homolog 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ROBO2
Synonyms:KIAA1568
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000185008.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10250 ROBO2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602431 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HCK4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini22 – 859ExtracellularSequence analysisAdd BLAST838
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei860 – 880HelicalSequence analysisAdd BLAST21
Topological domaini881 – 1378CytoplasmicSequence analysisAdd BLAST498

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Vesicoureteral reflux 2 (VUR2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease.
See also OMIM:610878
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032960945I → T in VUR2. 1 PublicationCorresponds to variant dbSNP:rs267607014EnsemblClinVar.1
Natural variantiVAR_0329611236A → T in VUR2. 1 PublicationCorresponds to variant dbSNP:rs267607015EnsemblClinVar.1
A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT-ROBO signaling in vitro.

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
6092

MalaCards human disease database

More...
MalaCardsi
ROBO2
MIMi610878 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000185008

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
289365 Familial vesicoureteral reflux

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34621

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ROBO2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
49036496

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003103622 – 1378Roundabout homolog 2Add BLAST1357

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi52 ↔ 110PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi123N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi154 ↔ 203PROSITE-ProRule annotation
Disulfide bondi246 ↔ 293PROSITE-ProRule annotation
Disulfide bondi335 ↔ 391PROSITE-ProRule annotation
Glycosylationi426N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi439 ↔ 488PROSITE-ProRule annotation
Glycosylationi752N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi782N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi789N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi845N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1154PhosphothreonineBy similarity1
Modified residuei1156PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HCK4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9HCK4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HCK4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HCK4

PeptideAtlas

More...
PeptideAtlasi
Q9HCK4

PRoteomics IDEntifications database

More...
PRIDEi
Q9HCK4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81744
81745 [Q9HCK4-2]
81746 [Q9HCK4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HCK4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HCK4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185008 Expressed in 148 organ(s), highest expression level in forebrain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HCK4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HCK4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA013371

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SLIT2.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112019, 20 interactors

Protein interaction database and analysis system

More...
IntActi
Q9HCK4, 29 interactors

Molecular INTeraction database

More...
MINTi
Q9HCK4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000417335

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11378
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UEMNMR-A514-617[»]
1UJTNMR-A628-734[»]
2EDJNMR-A417-509[»]
5NOIX-ray2.40A311-509[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9HCK4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HCK4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9HCK4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini31 – 127Ig-like C2-type 1Add BLAST97
Domaini133 – 220Ig-like C2-type 2Add BLAST88
Domaini225 – 309Ig-like C2-type 3Add BLAST85
Domaini314 – 409Ig-like C2-type 4Add BLAST96
Domaini418 – 504Ig-like C2-type 5Add BLAST87
Domaini524 – 618Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST95
Domaini637 – 735Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST99
Domaini739 – 836Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST98

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ROBO family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4222 Eukaryota
ENOG410XPQS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156324

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000010267

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG073476

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HCK4

KEGG Orthology (KO)

More...
KOi
K06754

Database of Orthologous Groups

More...
OrthoDBi
45439at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HCK4

TreeFam database of animal gene trees

More...
TreeFami
TF351053

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 8 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR032985 Robo2

The PANTHER Classification System

More...
PANTHERi
PTHR44096:SF2 PTHR44096:SF2, 3 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SM00406 IGv, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HCK4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLLMFTQLL LCGFLYVRVD GSRLRQEDFP PRIVEHPSDV IVSKGEPTTL
60 70 80 90 100
NCKAEGRPTP TIEWYKDGER VETDKDDPRS HRMLLPSGSL FFLRIVHGRR
110 120 130 140 150
SKPDEGSYVC VARNYLGEAV SRNASLEVAL LRDDFRQNPT DVVVAAGEPA
160 170 180 190 200
ILECQPPRGH PEPTIYWKKD KVRIDDKEER ISIRGGKLMI SNTRKSDAGM
210 220 230 240 250
YTCVGTNMVG ERDSDPAELT VFERPTFLRR PINQVVLEEE AVEFRCQVQG
260 270 280 290 300
DPQPTVRWKK DDADLPRGRY DIKDDYTLRI KKTMSTDEGT YMCIAENRVG
310 320 330 340 350
KMEASATLTV RAPPQFVVRP RDQIVAQGRT VTFPCETKGN PQPAVFWQKE
360 370 380 390 400
GSQNLLFPNQ PQQPNSRCSV SPTGDLTITN IQRSDAGYYI CQALTVAGSI
410 420 430 440 450
LAKAQLEVTD VLTDRPPPII LQGPANQTLA VDGTALLKCK ATGDPLPVIS
460 470 480 490 500
WLKEGFTFPG RDPRATIQEQ GTLQIKNLRI SDTGTYTCVA TSSSGETSWS
510 520 530 540 550
AVLDVTESGA TISKNYDLSD LPGPPSKPQV TDVTKNSVTL SWQPGTPGTL
560 570 580 590 600
PASAYIIEAF SQSVSNSWQT VANHVKTTLY TVRGLRPNTI YLFMVRAINP
610 620 630 640 650
QGLSDPSPMS DPVRTQDISP PAQGVDHRQV QKELGDVLVR LHNPVVLTPT
660 670 680 690 700
TVQVTWTVDR QPQFIQGYRV MYRQTSGLQA TSSWQNLDAK VPTERSAVLV
710 720 730 740 750
NLKKGVTYEI KVRPYFNEFQ GMDSESKTVR TTEEAPSAPP QSVTVLTVGS
760 770 780 790 800
YNSTSISVSW DPPPPDHQNG IIQEYKIWCL GNETRFHINK TVDAAIRSVI
810 820 830 840 850
IGGLFPGIQY RVEVAASTSA GVGVKSEPQP IIIGRRNEVV ITENNNSITE
860 870 880 890 900
QITDVVKQPA FIAGIGGACW VILMGFSIWL YWRRKKRKGL SNYAVTFQRG
910 920 930 940 950
DGGLMSNGSR PGLLNAGDPS YPWLADSWPA TSLPVNNSNS GPNEIGNFGR
960 970 980 990 1000
GDVLPPVPGQ GDKTATMLSD GAIYSSIDFT TKTSYNSSSQ ITQATPYATT
1010 1020 1030 1040 1050
QILHSNSIHE LAVDLPDPQW KSSIQQKTDL MGFGYSLPDQ NKGNNGGKGG
1060 1070 1080 1090 1100
KKKKNKNSSK PQKNNGSTWA NVPLPPPPVQ PLPGTELEHY AVEQQENGYD
1110 1120 1130 1140 1150
SDSWCPPLPV QTYLHQGLED ELEEDDDRVP TPPVRGVASS PAISFGQQST
1160 1170 1180 1190 1200
ATLTPSPREE MQPMLQAHLD ELTRAYQFDI AKQTWHIQSN NQPPQPPVPP
1210 1220 1230 1240 1250
LGYVSGALIS DLETDVADDD ADDEEEALEI PRPLRALDQT PGSSMDNLDS
1260 1270 1280 1290 1300
SVTGKAFTSS QRPRPTSPFS TDSNTSAALS QSQRPRPTKK HKGGRMDQQP
1310 1320 1330 1340 1350
ALPHRREGMT DEEALVPYSK PSFPSPGGHS SSGTASSKGS TGPRKTEVLR
1360 1370
AGHQRNASDL LDIGYMGSNS QGQFTGEL
Length:1,378
Mass (Da):151,200
Last modified:June 21, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i60F7CE3E53622B50
GO
Isoform 2 (identifier: Q9HCK4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1186-1378: Missing.

Show »
Length:1,185
Mass (Da):130,669
Checksum:i5A6ABDBD4A2111A3
GO
Isoform 3 (identifier: Q9HCK4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MSLLMFTQLLLCGFLYVRVD → MARRHERVTRRMWTWAPGLLMMTVVFWGHQGNGQGQ

Note: No experimental confirmation available.
Show »
Length:1,394
Mass (Da):153,120
Checksum:i860FFDE4892D51B7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W703F8W703_HUMAN
Roundabout homolog 2
ROBO2
1,439Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBR3F8WBR3_HUMAN
Roundabout homolog 2
ROBO2
564Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GMM8R4GMM8_HUMAN
Roundabout homolog 2
ROBO2
1,070Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWM5A0A087WWM5_HUMAN
Roundabout homolog 2
ROBO2
1,250Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4V8H7C4V8_HUMAN
Roundabout homolog 2
ROBO2
342Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4J7H7C4J7_HUMAN
Roundabout homolog 2
ROBO2
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4W9H7C4W9_HUMAN
Roundabout homolog 2
ROBO2
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4U9H7C4U9_HUMAN
Roundabout homolog 2
ROBO2
214Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC39576 differs from that shown. Reason: Frameshift at position 601.Curated
The sequence BAB13394 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti497T → A (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032960945I → T in VUR2. 1 PublicationCorresponds to variant dbSNP:rs267607014EnsemblClinVar.1
Natural variantiVAR_0329611236A → T in VUR2. 1 PublicationCorresponds to variant dbSNP:rs267607015EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0433941 – 20MSLLM…YVRVD → MARRHERVTRRMWTWAPGLL MMTVVFWGHQGNGQGQ in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0106471186 – 1378Missing in isoform 2. 1 PublicationAdd BLAST193

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ533874 mRNA Translation: ABF83431.1
AB046788 mRNA Translation: BAB13394.1 Different initiation.
DQ533873 mRNA Translation: ABF83430.1
AC016942 Genomic DNA No translation available.
AC016952 Genomic DNA No translation available.
AC024256 Genomic DNA No translation available.
AC026877 Genomic DNA No translation available.
AC067717 Genomic DNA No translation available.
AC117514 Genomic DNA No translation available.
AC117515 Genomic DNA No translation available.
AC117516 Genomic DNA No translation available.
AC126467 Genomic DNA No translation available.
AC130004 Genomic DNA No translation available.
AC131005 Genomic DNA No translation available.
AC131154 Genomic DNA No translation available.
AC133040 Genomic DNA No translation available.
AC138974 Genomic DNA No translation available.
BC064374 mRNA Translation: AAH64374.1
BC146772 mRNA Translation: AAI46773.1
AF040991 mRNA Translation: AAC39576.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43109.1 [Q9HCK4-1]
CCDS54609.1 [Q9HCK4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001122401.1, NM_001128929.3 [Q9HCK4-3]
NP_001276968.1, NM_001290039.1
NP_001276969.1, NM_001290040.1
NP_001276994.1, NM_001290065.1
NP_002933.1, NM_002942.4 [Q9HCK4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.13305

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000461745; ENSP00000417164; ENSG00000185008 [Q9HCK4-1]
ENST00000487694; ENSP00000417335; ENSG00000185008 [Q9HCK4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6092

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6092

UCSC genome browser

More...
UCSCi
uc003dpy.5 human [Q9HCK4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ533874 mRNA Translation: ABF83431.1
AB046788 mRNA Translation: BAB13394.1 Different initiation.
DQ533873 mRNA Translation: ABF83430.1
AC016942 Genomic DNA No translation available.
AC016952 Genomic DNA No translation available.
AC024256 Genomic DNA No translation available.
AC026877 Genomic DNA No translation available.
AC067717 Genomic DNA No translation available.
AC117514 Genomic DNA No translation available.
AC117515 Genomic DNA No translation available.
AC117516 Genomic DNA No translation available.
AC126467 Genomic DNA No translation available.
AC130004 Genomic DNA No translation available.
AC131005 Genomic DNA No translation available.
AC131154 Genomic DNA No translation available.
AC133040 Genomic DNA No translation available.
AC138974 Genomic DNA No translation available.
BC064374 mRNA Translation: AAH64374.1
BC146772 mRNA Translation: AAI46773.1
AF040991 mRNA Translation: AAC39576.1 Frameshift.
CCDSiCCDS43109.1 [Q9HCK4-1]
CCDS54609.1 [Q9HCK4-3]
RefSeqiNP_001122401.1, NM_001128929.3 [Q9HCK4-3]
NP_001276968.1, NM_001290039.1
NP_001276969.1, NM_001290040.1
NP_001276994.1, NM_001290065.1
NP_002933.1, NM_002942.4 [Q9HCK4-1]
UniGeneiHs.13305

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UEMNMR-A514-617[»]
1UJTNMR-A628-734[»]
2EDJNMR-A417-509[»]
5NOIX-ray2.40A311-509[»]
ProteinModelPortaliQ9HCK4
SMRiQ9HCK4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112019, 20 interactors
IntActiQ9HCK4, 29 interactors
MINTiQ9HCK4
STRINGi9606.ENSP00000417335

PTM databases

iPTMnetiQ9HCK4
PhosphoSitePlusiQ9HCK4

Polymorphism and mutation databases

BioMutaiROBO2
DMDMi49036496

Proteomic databases

EPDiQ9HCK4
jPOSTiQ9HCK4
MaxQBiQ9HCK4
PaxDbiQ9HCK4
PeptideAtlasiQ9HCK4
PRIDEiQ9HCK4
ProteomicsDBi81744
81745 [Q9HCK4-2]
81746 [Q9HCK4-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000461745; ENSP00000417164; ENSG00000185008 [Q9HCK4-1]
ENST00000487694; ENSP00000417335; ENSG00000185008 [Q9HCK4-3]
GeneIDi6092
KEGGihsa:6092
UCSCiuc003dpy.5 human [Q9HCK4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6092
DisGeNETi6092
EuPathDBiHostDB:ENSG00000185008.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ROBO2
HGNCiHGNC:10250 ROBO2
HPAiHPA013371
MalaCardsiROBO2
MIMi602431 gene
610878 phenotype
neXtProtiNX_Q9HCK4
OpenTargetsiENSG00000185008
Orphaneti289365 Familial vesicoureteral reflux
PharmGKBiPA34621

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4222 Eukaryota
ENOG410XPQS LUCA
GeneTreeiENSGT00940000156324
HOGENOMiHOG000010267
HOVERGENiHBG073476
InParanoidiQ9HCK4
KOiK06754
OrthoDBi45439at2759
PhylomeDBiQ9HCK4
TreeFamiTF351053

Enzyme and pathway databases

ReactomeiR-HSA-376176 Signaling by ROBO receptors
R-HSA-428542 Regulation of commissural axon pathfinding by SLIT and ROBO
R-HSA-8985801 Regulation of cortical dendrite branching
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-9010642 ROBO receptors bind AKAP5

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ROBO2 human
EvolutionaryTraceiQ9HCK4

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ROBO2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6092

Protein Ontology

More...
PROi
PR:Q9HCK4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000185008 Expressed in 148 organ(s), highest expression level in forebrain
ExpressionAtlasiQ9HCK4 baseline and differential
GenevisibleiQ9HCK4 HS

Family and domain databases

CDDicd00063 FN3, 3 hits
Gene3Di2.60.40.10, 8 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR032985 Robo2
PANTHERiPTHR44096:SF2 PTHR44096:SF2, 3 hits
PfamiView protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 2 hits
SMARTiView protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SM00406 IGv, 3 hits
SUPFAMiSSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiROBO2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HCK4
Secondary accession number(s): O43608, Q19AB4, Q19AB5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 21, 2004
Last modified: February 13, 2019
This is version 171 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again