Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Roundabout homolog 2

Gene

ROBO2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development.

GO - Molecular functioni

  • axon guidance receptor activity Source: UniProtKB
  • identical protein binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processChemotaxis, Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-HSA-376176 Signaling by ROBO receptors
R-HSA-428542 Regulation of commissural axon pathfinding by SLIT and ROBO
R-HSA-8985801 Regulation of cortical dendrite branching
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-9010642 ROBO receptors bind AKAP5

Names & Taxonomyi

Protein namesi
Recommended name:
Roundabout homolog 2
Gene namesi
Name:ROBO2
Synonyms:KIAA1568
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000185008.17
HGNCiHGNC:10250 ROBO2
MIMi602431 gene
neXtProtiNX_Q9HCK4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 859ExtracellularSequence analysisAdd BLAST838
Transmembranei860 – 880HelicalSequence analysisAdd BLAST21
Topological domaini881 – 1378CytoplasmicSequence analysisAdd BLAST498

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Involvement in diseasei

Vesicoureteral reflux 2 (VUR2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease.
See also OMIM:610878
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032960945I → T in VUR2. 1 PublicationCorresponds to variant dbSNP:rs267607014EnsemblClinVar.1
Natural variantiVAR_0329611236A → T in VUR2. 1 PublicationCorresponds to variant dbSNP:rs267607015EnsemblClinVar.1
A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT-ROBO signaling in vitro.

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi6092
MalaCardsiROBO2
MIMi610878 phenotype
OpenTargetsiENSG00000185008
Orphaneti289365 Familial vesicoureteral reflux
PharmGKBiPA34621

Polymorphism and mutation databases

BioMutaiROBO2
DMDMi49036496

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000003103622 – 1378Roundabout homolog 2Add BLAST1357

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi52 ↔ 110PROSITE-ProRule annotation
Glycosylationi123N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi154 ↔ 203PROSITE-ProRule annotation
Disulfide bondi246 ↔ 293PROSITE-ProRule annotation
Disulfide bondi335 ↔ 391PROSITE-ProRule annotation
Glycosylationi426N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi439 ↔ 488PROSITE-ProRule annotation
Glycosylationi752N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi782N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi789N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi845N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei1154PhosphothreonineBy similarity1
Modified residuei1156PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9HCK4
MaxQBiQ9HCK4
PaxDbiQ9HCK4
PeptideAtlasiQ9HCK4
PRIDEiQ9HCK4
ProteomicsDBi81744
81745 [Q9HCK4-2]
81746 [Q9HCK4-3]

PTM databases

iPTMnetiQ9HCK4
PhosphoSitePlusiQ9HCK4

Expressioni

Gene expression databases

BgeeiENSG00000185008 Expressed in 148 organ(s), highest expression level in forebrain
CleanExiHS_ROBO2
ExpressionAtlasiQ9HCK4 baseline and differential
GenevisibleiQ9HCK4 HS

Organism-specific databases

HPAiHPA013371

Interactioni

Subunit structurei

Interacts with SLIT2.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112019, 20 interactors
IntActiQ9HCK4, 28 interactors
MINTiQ9HCK4
STRINGi9606.ENSP00000417335

Structurei

Secondary structure

11378
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9HCK4
SMRiQ9HCK4
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HCK4

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini31 – 127Ig-like C2-type 1Add BLAST97
Domaini133 – 220Ig-like C2-type 2Add BLAST88
Domaini225 – 309Ig-like C2-type 3Add BLAST85
Domaini314 – 409Ig-like C2-type 4Add BLAST96
Domaini418 – 504Ig-like C2-type 5Add BLAST87
Domaini524 – 618Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST95
Domaini637 – 735Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST99
Domaini739 – 836Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST98

Sequence similaritiesi

Belongs to the immunoglobulin superfamily. ROBO family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4222 Eukaryota
ENOG410XPQS LUCA
GeneTreeiENSGT00930000150875
HOGENOMiHOG000010267
HOVERGENiHBG073476
InParanoidiQ9HCK4
KOiK06754
PhylomeDBiQ9HCK4
TreeFamiTF351053

Family and domain databases

CDDicd00063 FN3, 3 hits
Gene3Di2.60.40.10, 8 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR032985 Robo2
PANTHERiPTHR44096:SF2 PTHR44096:SF2, 3 hits
PfamiView protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 2 hits
SMARTiView protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SM00406 IGv, 3 hits
SUPFAMiSSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 5 hits

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HCK4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLLMFTQLL LCGFLYVRVD GSRLRQEDFP PRIVEHPSDV IVSKGEPTTL
60 70 80 90 100
NCKAEGRPTP TIEWYKDGER VETDKDDPRS HRMLLPSGSL FFLRIVHGRR
110 120 130 140 150
SKPDEGSYVC VARNYLGEAV SRNASLEVAL LRDDFRQNPT DVVVAAGEPA
160 170 180 190 200
ILECQPPRGH PEPTIYWKKD KVRIDDKEER ISIRGGKLMI SNTRKSDAGM
210 220 230 240 250
YTCVGTNMVG ERDSDPAELT VFERPTFLRR PINQVVLEEE AVEFRCQVQG
260 270 280 290 300
DPQPTVRWKK DDADLPRGRY DIKDDYTLRI KKTMSTDEGT YMCIAENRVG
310 320 330 340 350
KMEASATLTV RAPPQFVVRP RDQIVAQGRT VTFPCETKGN PQPAVFWQKE
360 370 380 390 400
GSQNLLFPNQ PQQPNSRCSV SPTGDLTITN IQRSDAGYYI CQALTVAGSI
410 420 430 440 450
LAKAQLEVTD VLTDRPPPII LQGPANQTLA VDGTALLKCK ATGDPLPVIS
460 470 480 490 500
WLKEGFTFPG RDPRATIQEQ GTLQIKNLRI SDTGTYTCVA TSSSGETSWS
510 520 530 540 550
AVLDVTESGA TISKNYDLSD LPGPPSKPQV TDVTKNSVTL SWQPGTPGTL
560 570 580 590 600
PASAYIIEAF SQSVSNSWQT VANHVKTTLY TVRGLRPNTI YLFMVRAINP
610 620 630 640 650
QGLSDPSPMS DPVRTQDISP PAQGVDHRQV QKELGDVLVR LHNPVVLTPT
660 670 680 690 700
TVQVTWTVDR QPQFIQGYRV MYRQTSGLQA TSSWQNLDAK VPTERSAVLV
710 720 730 740 750
NLKKGVTYEI KVRPYFNEFQ GMDSESKTVR TTEEAPSAPP QSVTVLTVGS
760 770 780 790 800
YNSTSISVSW DPPPPDHQNG IIQEYKIWCL GNETRFHINK TVDAAIRSVI
810 820 830 840 850
IGGLFPGIQY RVEVAASTSA GVGVKSEPQP IIIGRRNEVV ITENNNSITE
860 870 880 890 900
QITDVVKQPA FIAGIGGACW VILMGFSIWL YWRRKKRKGL SNYAVTFQRG
910 920 930 940 950
DGGLMSNGSR PGLLNAGDPS YPWLADSWPA TSLPVNNSNS GPNEIGNFGR
960 970 980 990 1000
GDVLPPVPGQ GDKTATMLSD GAIYSSIDFT TKTSYNSSSQ ITQATPYATT
1010 1020 1030 1040 1050
QILHSNSIHE LAVDLPDPQW KSSIQQKTDL MGFGYSLPDQ NKGNNGGKGG
1060 1070 1080 1090 1100
KKKKNKNSSK PQKNNGSTWA NVPLPPPPVQ PLPGTELEHY AVEQQENGYD
1110 1120 1130 1140 1150
SDSWCPPLPV QTYLHQGLED ELEEDDDRVP TPPVRGVASS PAISFGQQST
1160 1170 1180 1190 1200
ATLTPSPREE MQPMLQAHLD ELTRAYQFDI AKQTWHIQSN NQPPQPPVPP
1210 1220 1230 1240 1250
LGYVSGALIS DLETDVADDD ADDEEEALEI PRPLRALDQT PGSSMDNLDS
1260 1270 1280 1290 1300
SVTGKAFTSS QRPRPTSPFS TDSNTSAALS QSQRPRPTKK HKGGRMDQQP
1310 1320 1330 1340 1350
ALPHRREGMT DEEALVPYSK PSFPSPGGHS SSGTASSKGS TGPRKTEVLR
1360 1370
AGHQRNASDL LDIGYMGSNS QGQFTGEL
Length:1,378
Mass (Da):151,200
Last modified:June 21, 2004 - v2
Checksum:i60F7CE3E53622B50
GO
Isoform 2 (identifier: Q9HCK4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1186-1378: Missing.

Show »
Length:1,185
Mass (Da):130,669
Checksum:i5A6ABDBD4A2111A3
GO
Isoform 3 (identifier: Q9HCK4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MSLLMFTQLLLCGFLYVRVD → MARRHERVTRRMWTWAPGLLMMTVVFWGHQGNGQGQ

Note: No experimental confirmation available.
Show »
Length:1,394
Mass (Da):153,120
Checksum:i860FFDE4892D51B7
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W703F8W703_HUMAN
Roundabout homolog 2
ROBO2
1,439Annotation score:
F8WBR3F8WBR3_HUMAN
Roundabout homolog 2
ROBO2
564Annotation score:
R4GMM8R4GMM8_HUMAN
Roundabout homolog 2
ROBO2
1,070Annotation score:
A0A087WWM5A0A087WWM5_HUMAN
Roundabout homolog 2
ROBO2
1,250Annotation score:
H7C4V8H7C4V8_HUMAN
Roundabout homolog 2
ROBO2
342Annotation score:
H7C4J7H7C4J7_HUMAN
Roundabout homolog 2
ROBO2
198Annotation score:
H7C4W9H7C4W9_HUMAN
Roundabout homolog 2
ROBO2
208Annotation score:
H7C4U9H7C4U9_HUMAN
Roundabout homolog 2
ROBO2
214Annotation score:

Sequence cautioni

The sequence AAC39576 differs from that shown. Reason: Frameshift at position 601.Curated
The sequence BAB13394 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti497T → A (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032960945I → T in VUR2. 1 PublicationCorresponds to variant dbSNP:rs267607014EnsemblClinVar.1
Natural variantiVAR_0329611236A → T in VUR2. 1 PublicationCorresponds to variant dbSNP:rs267607015EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0433941 – 20MSLLM…YVRVD → MARRHERVTRRMWTWAPGLL MMTVVFWGHQGNGQGQ in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0106471186 – 1378Missing in isoform 2. 1 PublicationAdd BLAST193

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ533874 mRNA Translation: ABF83431.1
AB046788 mRNA Translation: BAB13394.1 Different initiation.
DQ533873 mRNA Translation: ABF83430.1
AC016942 Genomic DNA No translation available.
AC016952 Genomic DNA No translation available.
AC024256 Genomic DNA No translation available.
AC026877 Genomic DNA No translation available.
AC067717 Genomic DNA No translation available.
AC117514 Genomic DNA No translation available.
AC117515 Genomic DNA No translation available.
AC117516 Genomic DNA No translation available.
AC126467 Genomic DNA No translation available.
AC130004 Genomic DNA No translation available.
AC131005 Genomic DNA No translation available.
AC131154 Genomic DNA No translation available.
AC133040 Genomic DNA No translation available.
AC138974 Genomic DNA No translation available.
BC064374 mRNA Translation: AAH64374.1
BC146772 mRNA Translation: AAI46773.1
AF040991 mRNA Translation: AAC39576.1 Frameshift.
CCDSiCCDS43109.1 [Q9HCK4-1]
CCDS54609.1 [Q9HCK4-3]
RefSeqiNP_001122401.1, NM_001128929.3 [Q9HCK4-3]
NP_001276968.1, NM_001290039.1
NP_001276969.1, NM_001290040.1
NP_001276994.1, NM_001290065.1
NP_002933.1, NM_002942.4 [Q9HCK4-1]
UniGeneiHs.13305

Genome annotation databases

EnsembliENST00000461745; ENSP00000417164; ENSG00000185008 [Q9HCK4-1]
ENST00000487694; ENSP00000417335; ENSG00000185008 [Q9HCK4-3]
GeneIDi6092
KEGGihsa:6092
UCSCiuc003dpy.5 human [Q9HCK4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ533874 mRNA Translation: ABF83431.1
AB046788 mRNA Translation: BAB13394.1 Different initiation.
DQ533873 mRNA Translation: ABF83430.1
AC016942 Genomic DNA No translation available.
AC016952 Genomic DNA No translation available.
AC024256 Genomic DNA No translation available.
AC026877 Genomic DNA No translation available.
AC067717 Genomic DNA No translation available.
AC117514 Genomic DNA No translation available.
AC117515 Genomic DNA No translation available.
AC117516 Genomic DNA No translation available.
AC126467 Genomic DNA No translation available.
AC130004 Genomic DNA No translation available.
AC131005 Genomic DNA No translation available.
AC131154 Genomic DNA No translation available.
AC133040 Genomic DNA No translation available.
AC138974 Genomic DNA No translation available.
BC064374 mRNA Translation: AAH64374.1
BC146772 mRNA Translation: AAI46773.1
AF040991 mRNA Translation: AAC39576.1 Frameshift.
CCDSiCCDS43109.1 [Q9HCK4-1]
CCDS54609.1 [Q9HCK4-3]
RefSeqiNP_001122401.1, NM_001128929.3 [Q9HCK4-3]
NP_001276968.1, NM_001290039.1
NP_001276969.1, NM_001290040.1
NP_001276994.1, NM_001290065.1
NP_002933.1, NM_002942.4 [Q9HCK4-1]
UniGeneiHs.13305

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1UEMNMR-A514-617[»]
1UJTNMR-A628-734[»]
2EDJNMR-A417-509[»]
5NOIX-ray2.40A311-509[»]
ProteinModelPortaliQ9HCK4
SMRiQ9HCK4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112019, 20 interactors
IntActiQ9HCK4, 28 interactors
MINTiQ9HCK4
STRINGi9606.ENSP00000417335

PTM databases

iPTMnetiQ9HCK4
PhosphoSitePlusiQ9HCK4

Polymorphism and mutation databases

BioMutaiROBO2
DMDMi49036496

Proteomic databases

EPDiQ9HCK4
MaxQBiQ9HCK4
PaxDbiQ9HCK4
PeptideAtlasiQ9HCK4
PRIDEiQ9HCK4
ProteomicsDBi81744
81745 [Q9HCK4-2]
81746 [Q9HCK4-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000461745; ENSP00000417164; ENSG00000185008 [Q9HCK4-1]
ENST00000487694; ENSP00000417335; ENSG00000185008 [Q9HCK4-3]
GeneIDi6092
KEGGihsa:6092
UCSCiuc003dpy.5 human [Q9HCK4-1]

Organism-specific databases

CTDi6092
DisGeNETi6092
EuPathDBiHostDB:ENSG00000185008.17
GeneCardsiROBO2
HGNCiHGNC:10250 ROBO2
HPAiHPA013371
MalaCardsiROBO2
MIMi602431 gene
610878 phenotype
neXtProtiNX_Q9HCK4
OpenTargetsiENSG00000185008
Orphaneti289365 Familial vesicoureteral reflux
PharmGKBiPA34621
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4222 Eukaryota
ENOG410XPQS LUCA
GeneTreeiENSGT00930000150875
HOGENOMiHOG000010267
HOVERGENiHBG073476
InParanoidiQ9HCK4
KOiK06754
PhylomeDBiQ9HCK4
TreeFamiTF351053

Enzyme and pathway databases

ReactomeiR-HSA-376176 Signaling by ROBO receptors
R-HSA-428542 Regulation of commissural axon pathfinding by SLIT and ROBO
R-HSA-8985801 Regulation of cortical dendrite branching
R-HSA-9010553 Regulation of expression of SLITs and ROBOs
R-HSA-9010642 ROBO receptors bind AKAP5

Miscellaneous databases

ChiTaRSiROBO2 human
EvolutionaryTraceiQ9HCK4
GeneWikiiROBO2
GenomeRNAii6092
PROiPR:Q9HCK4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185008 Expressed in 148 organ(s), highest expression level in forebrain
CleanExiHS_ROBO2
ExpressionAtlasiQ9HCK4 baseline and differential
GenevisibleiQ9HCK4 HS

Family and domain databases

CDDicd00063 FN3, 3 hits
Gene3Di2.60.40.10, 8 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR032985 Robo2
PANTHERiPTHR44096:SF2 PTHR44096:SF2, 3 hits
PfamiView protein in Pfam
PF00041 fn3, 3 hits
PF07679 I-set, 2 hits
SMARTiView protein in SMART
SM00060 FN3, 3 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SM00406 IGv, 3 hits
SUPFAMiSSF48726 SSF48726, 5 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 3 hits
PS50835 IG_LIKE, 5 hits
ProtoNetiSearch...

Entry informationi

Entry nameiROBO2_HUMAN
AccessioniPrimary (citable) accession number: Q9HCK4
Secondary accession number(s): O43608, Q19AB4, Q19AB5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 21, 2004
Last modified: November 7, 2018
This is version 168 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again