Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trinucleotide repeat-containing gene 6C protein

Gene

TNRC6C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in RNA-mediated gene silencing by micro-RNAs (miRNAs). Required for miRNA-dependent translational repression of complementary mRNAs by argonaute family proteins. As scaffoldng protein associates with argonaute proteins bound to partially complementary mRNAs and simultaneously can recruit CCR4-NOT and PAN deadenylase complexes.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processRNA-mediated gene silencing, Translation regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1912408 Pre-NOTCH Transcription and Translation
R-HSA-2559580 Oxidative Stress Induced Senescence
R-HSA-2559585 Oncogene Induced Senescence
R-HSA-4086398 Ca2+ pathway
R-HSA-426496 Post-transcriptional silencing by small RNAs
R-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-5687128 MAPK6/MAPK4 signaling
R-HSA-8934593 Regulation of RUNX1 Expression and Activity
R-HSA-8936459 RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
R-HSA-8943723 Regulation of PTEN mRNA translation
R-HSA-8948700 Competing endogenous RNAs (ceRNAs) regulate PTEN translation
R-HSA-8986944 Transcriptional Regulation by MECP2
R-HSA-9018519 Estrogen-dependent gene expression
R-HSA-9022692 Regulation of MECP2 expression and activity

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Trinucleotide repeat-containing gene 6C protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNRC6C
Synonyms:KIAA1582
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000078687.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29318 TNRC6C

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610741 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HCJ0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1294 – 1300QSRLPQW → AAAAPAA: Abolishes association with CCR4-NOT complex. 7
Mutagenesisi1388 – 1389EF → AA: Abolishes interaction with PABPC1, impairs interaction with PAN2, no effect on interaction with CCR4-NOT complex, reduces RNA deadenylation rate; when associated with 1395-A-A-1396. 2
Mutagenesisi1395 – 1396WK → AA: Abolishes interaction with PABPC1, impairs interaction with PAN2, no effect on interaction with CCR4-NOT complex, reduces RNA deadenylation rate; when associated with 1388-A-A-1389. 2
Mutagenesisi1445W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1487, A-1494, A-1504, A-1515, A-1605 and A-1648. 1 Publication1
Mutagenesisi1487W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1494, A-1504, A-1515, A-1605 and A-1648. 1 Publication1
Mutagenesisi1494W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1504, A-1515, A-1605 and A-1648. 1 Publication1
Mutagenesisi1504W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1494, A-1515, A-1605 and A-1648. 1 Publication1
Mutagenesisi1515W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1494, A-1504, A-1605 and A-1648. 1 Publication1
Mutagenesisi1537H → A: Strongly reduced ability to repress translation of target mRNAs. 1 Publication1
Mutagenesisi1543F → A: Weakly reduced ability to repress translation of target mRNAs. 1 Publication1
Mutagenesisi1556Y → A: Strongly reduced ability to repress translation of target mRNAs. 1 Publication1
Mutagenesisi1605W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1494, A-1504, A-1515 and A-1648. 1 Publication1
Mutagenesisi1647 – 1649LWG → AAA: Impairs interaction with the CCR4-NOT complex, no effect on interaction with PABPC1; when associated with 1658-A-A-1660. 3
Mutagenesisi1648W → A: Abolishes translational repression when tethered to a target mRNA, abolishes association with the CCR4-NOT complex; when associated with A-1445, A-1487, A-1494, A-1504, A-1515 and A-1605. 1 Publication1
Mutagenesisi1658 – 1660LWG → AAA: Impairs interaction with the CCR4-NOT complex, no effect on interaction with PABPC1; when associated with 1647-A-A-1649. 3

Organism-specific databases

DisGeNET

More...
DisGeNETi
57690

Open Targets

More...
OpenTargetsi
ENSG00000078687

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134880671

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TNRC6C

Domain mapping of disease mutations (DMDM)

More...
DMDMi
126253813

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002785261 – 1690Trinucleotide repeat-containing gene 6C proteinAdd BLAST1690

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei313Omega-N-methylarginineCombined sources1
Modified residuei465PhosphoserineBy similarity1
Modified residuei714PhosphoserineCombined sources1
Modified residuei777PhosphothreonineCombined sources1
Modified residuei1011PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HCJ0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HCJ0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HCJ0

PeptideAtlas

More...
PeptideAtlasi
Q9HCJ0

PRoteomics IDEntifications database

More...
PRIDEi
Q9HCJ0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81734
81735 [Q9HCJ0-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HCJ0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HCJ0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000078687 Expressed in 187 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_TNRC6C

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HCJ0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HCJ0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA022007
HPA062051

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with one or more of the argonaute family proteins AGO1, AGO2, AGO3 and AGO4. Interacts with PABPC1 and EIF4G1. Interacts with CNOT1; the interaction is direct and mediates the association with the CCR4-NOT complex. Interacts with PAN3; the interaction mediates the association with the PAN complex.6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121716, 34 interactors

Database of interacting proteins

More...
DIPi
DIP-48569N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9HCJ0

Protein interaction database and analysis system

More...
IntActi
Q9HCJ0, 33 interactors

Molecular INTeraction database

More...
MINTi
Q9HCJ0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000336783

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11690
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9HCJ0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HCJ0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9HCJ0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini933 – 978UBAPROSITE-ProRule annotationAdd BLAST46
Domaini1565 – 1632RRMAdd BLAST68

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 926Sufficient for interaction with argonaute family proteinsAdd BLAST926
Regioni1260 – 1690Silencing domain; interaction with CNOT1 and PAN31 PublicationAdd BLAST431
Regioni1371 – 1690Sufficient for translational repression when tethered to a target mRNAAdd BLAST320
Regioni1371 – 1417Required for interaction with PABPC1Add BLAST47
Regioni1381 – 1399PABPC1-interacting motif-2 (PAM2)Add BLAST19
Regioni1596 – 1690Interaction with the CCR4-NOT complexAdd BLAST95

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1156 – 1214Sequence analysisAdd BLAST59

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi204 – 430Gly-richAdd BLAST227
Compositional biasi549 – 552Poly-Ala4
Compositional biasi756 – 777Thr-richAdd BLAST22
Compositional biasi1215 – 1248Pro-richAdd BLAST34

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The silencing domain, also known as C-terminal effector domain (CED), can act in autonomous repression, including both translational inhibition and mRNA degradation.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GW182 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFAU Eukaryota
ENOG41110AX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157598

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000049171

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG062594

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HCJ0

KEGG Orthology (KO)

More...
KOi
K18412

Database of Orthologous Groups

More...
OrthoDBi
EOG091G00G6

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HCJ0

TreeFam database of animal gene trees

More...
TreeFami
TF329702

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12713 RRM_TNRC6C, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019486 Argonaute_hook_dom
IPR026805 GW182_M_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR032226 TNRC6_PABC-bd
IPR033499 TNRC6C
IPR034927 TNRC6C_RRM
IPR015940 UBA
IPR009060 UBA-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR13020:SF9 PTHR13020:SF9, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10427 Ago_hook, 1 hit
PF12938 M_domain, 1 hit
PF00076 RRM_1, 1 hit
PF16608 TNRC6-PABC_bdg, 2 hits
PF00627 UBA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00165 UBA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934 SSF46934, 1 hit
SSF54928 SSF54928, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50030 UBA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HCJ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGSAQGNF TGHTKKTNGN NGTNGALVQS PSNQSALGAG GANSNGSAAR
60 70 80 90 100
VWGVATGSSS GLAHCSVSGG DGKMDTMIGD GRSQNCWGAS NSNAGINLNL
110 120 130 140 150
NPNANPAAWP VLGHEGTVAT GNPSSICSPV SAIGQNMGNQ NGNPTGTLGA
160 170 180 190 200
WGNLLPQEST EPQTSTSQNV SFSAQPQNLN TDGPNNTNPM NSSPNPINAM
210 220 230 240 250
QTNGLPNWGM AVGMGAIIPP HLQGLPGANG SSVSQVSGGS AEGISNSVWG
260 270 280 290 300
LSPGNPATGN SNSGFSQGNG DTVNSALSAK QNGSSSAVQK EGSGGNAWDS
310 320 330 340 350
GPPAGPGILA WGRGSGNNGV GNIHSGAWGH PSRSTSNGVN GEWGKPPNQH
360 370 380 390 400
SNSDINGKGS TGWESPSVTS QNPTVQPGGE HMNSWAKAAS SGTTASEGSS
410 420 430 440 450
DGSGNHNEGS TGREGTGEGR RRDKGIIDQG HIQLPRNDLD PRVLSNTGWG
460 470 480 490 500
QTPVKQNTAW EFEESPRSER KNDNGTEAWG CAATQASNSG GKNDGSIMNS
510 520 530 540 550
TNTSSVSGWV NAPPAAVPAN TGWGDSNNKA PSGPGVWGDS ISSTAVSTAA
560 570 580 590 600
AAKSGHAWSG AANQEDKSPT WGEPPKPKSQ HWGDGQRSNP AWSAGGGDWA
610 620 630 640 650
DSSSVLGHLG DGKKNGSGWD ADSNRSGSGW NDTTRSGNSG WGNSTNTKAN
660 670 680 690 700
PGTNWGETLK PGPQQNWASK PQDNNVSNWG GAASVKQTGT GWIGGPVPVK
710 720 730 740 750
QKDSSEATGW EEPSPPSIRR KMEIDDGTSA WGDPSNYNNK TVNMWDRNNP
760 770 780 790 800
VIQSSTTTNT TTTTTTTTSN TTHRVETPPP HQAGTQLNRS PLLGPGRKVS
810 820 830 840 850
SGWGEMPNVH SKTENSWGEP SSPSTLVDNG TAAWGKPPSS GSGWGDHPAE
860 870 880 890 900
PPVAFGRAGA PVAASALCKP ASKSMQEGWG SGGDEMNLST SQWEDEEGDV
910 920 930 940 950
WNNAASQEST SSCSSWGNAP KKGLQKGMKT SGKQDEAWIM SRLIKQLTDM
960 970 980 990 1000
GFPREPAEEA LKSNNMNLDQ AMSALLEKKV DVDKRGLGVT DHNGMAAKPL
1010 1020 1030 1040 1050
GCRPPISKES SVDRPTFLDK DGGLVEEPTP SPFLPSPSLK LPLSHSALPS
1060 1070 1080 1090 1100
QALGGIASGL GMQNLNSSRQ IPSGNLGMFG NSGAAQARTM QQPPQPPVQP
1110 1120 1130 1140 1150
LNSSQPSLRA QVPQFLSPQV QAQLLQFAAK NIGLNPALLT SPINPQHMTM
1160 1170 1180 1190 1200
LNQLYQLQLA YQRLQIQQQM LQAQRNVSGS MRQQEQQVAR TITNLQQQIQ
1210 1220 1230 1240 1250
QHQRQLAQAL LVKQPPPPPP PPHLSLHPSA GKSAMDSFPS HPQTPGLPDL
1260 1270 1280 1290 1300
QTKEQQSSPN TFAPYPLAGL NPNMNVNSMD MTGGLSVKDP SQSQSRLPQW
1310 1320 1330 1340 1350
THPNSMDNLP SAASPLEQNP SKHGAIPGGL SIGPPGKSSI DDSYGRYDLI
1360 1370 1380 1390 1400
QNSESPASPP VAVPHSWSRA KSDSDKISNG SSINWPPEFH PGVPWKGLQN
1410 1420 1430 1440 1450
IDPENDPDVT PGSVPTGPTI NTTIQDVNRY LLKSGGKLSD IKSTWSSGPT
1460 1470 1480 1490 1500
SHTQASLSHE LWKVPRNSTA PTRPPPGLTN PKPSSTWGAS PLGWTSSYSS
1510 1520 1530 1540 1550
GSAWSTDTSG RTSSWLVLRN LTPQIDGSTL RTLCLQHGPL ITFHLNLTQG
1560 1570 1580 1590 1600
NAVVRYSSKE EAAKAQKSLH MCVLGNTTIL AEFAGEEEVN RFLAQGQALP
1610 1620 1630 1640 1650
PTSSWQSSSA SSQPRLSAAG SSHGLVRSDA GHWNAPCLGG KGSSELLWGG
1660 1670 1680 1690
VPQYSSSLWG PPSADDSRVI GSPTPLTTLL PGDLLSGESL
Length:1,690
Mass (Da):175,964
Last modified:February 20, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC8230D65BFB1DA0B
GO
Isoform 2 (identifier: Q9HCJ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     796-798: Missing.
     1435-1435: G → GGSSPPSSQNATLPSSSAWPLSASGYSSSFSSIASAPSVA

Show »
Length:1,726
Mass (Da):179,321
Checksum:iE1C90F44281A7B52
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GU24A0A1B0GU24_HUMAN
Trinucleotide repeat-containing gen...
TNRC6C
1,944Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ELY5K7ELY5_HUMAN
Trinucleotide repeat-containing gen...
TNRC6C
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKN9K7EKN9_HUMAN
Trinucleotide repeat-containing gen...
TNRC6C
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB13408 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB71179 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti728T → S in AAH45631 (PubMed:15489334).Curated1
Sequence conflicti1231G → C in AAH45631 (PubMed:15489334).Curated1
Sequence conflicti1555R → P in AAH45631 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052237820P → R. Corresponds to variant dbSNP:rs34293811Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_054230796 – 798Missing in isoform 2. 2 Publications3
Alternative sequenceiVSP_0233221435G → GGSSPPSSQNATLPSSSAWP LSASGYSSSFSSIASAPSVA in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB046802 mRNA Translation: BAB13408.2 Different initiation.
AC021593 Genomic DNA No translation available.
AC015804 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89480.1
AL834429 mRNA Translation: CAD39090.1
BC045631 mRNA Translation: AAH45631.1
AK056421 mRNA Translation: BAB71179.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45798.1 [Q9HCJ0-1]
CCDS45799.1 [Q9HCJ0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001136112.1, NM_001142640.1 [Q9HCJ0-2]
NP_061869.2, NM_018996.3 [Q9HCJ0-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.406810
Hs.569831

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000301624; ENSP00000301624; ENSG00000078687 [Q9HCJ0-1]
ENST00000335749; ENSP00000336783; ENSG00000078687 [Q9HCJ0-2]
ENST00000588061; ENSP00000468647; ENSG00000078687 [Q9HCJ0-1]
ENST00000588847; ENSP00000467154; ENSG00000078687 [Q9HCJ0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57690

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57690

UCSC genome browser

More...
UCSCi
uc002juc.3 human [Q9HCJ0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046802 mRNA Translation: BAB13408.2 Different initiation.
AC021593 Genomic DNA No translation available.
AC015804 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89480.1
AL834429 mRNA Translation: CAD39090.1
BC045631 mRNA Translation: AAH45631.1
AK056421 mRNA Translation: BAB71179.1 Different initiation.
CCDSiCCDS45798.1 [Q9HCJ0-1]
CCDS45799.1 [Q9HCJ0-2]
RefSeqiNP_001136112.1, NM_001142640.1 [Q9HCJ0-2]
NP_061869.2, NM_018996.3 [Q9HCJ0-1]
UniGeneiHs.406810
Hs.569831

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DKLNMR-A927-998[»]
2X04X-ray1.49C/D1382-1399[»]
3KTPX-ray1.50B1380-1401[»]
ProteinModelPortaliQ9HCJ0
SMRiQ9HCJ0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121716, 34 interactors
DIPiDIP-48569N
ELMiQ9HCJ0
IntActiQ9HCJ0, 33 interactors
MINTiQ9HCJ0
STRINGi9606.ENSP00000336783

PTM databases

iPTMnetiQ9HCJ0
PhosphoSitePlusiQ9HCJ0

Polymorphism and mutation databases

BioMutaiTNRC6C
DMDMi126253813

Proteomic databases

EPDiQ9HCJ0
MaxQBiQ9HCJ0
PaxDbiQ9HCJ0
PeptideAtlasiQ9HCJ0
PRIDEiQ9HCJ0
ProteomicsDBi81734
81735 [Q9HCJ0-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301624; ENSP00000301624; ENSG00000078687 [Q9HCJ0-1]
ENST00000335749; ENSP00000336783; ENSG00000078687 [Q9HCJ0-2]
ENST00000588061; ENSP00000468647; ENSG00000078687 [Q9HCJ0-1]
ENST00000588847; ENSP00000467154; ENSG00000078687 [Q9HCJ0-2]
GeneIDi57690
KEGGihsa:57690
UCSCiuc002juc.3 human [Q9HCJ0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57690
DisGeNETi57690
EuPathDBiHostDB:ENSG00000078687.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TNRC6C

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0014215
HGNCiHGNC:29318 TNRC6C
HPAiHPA022007
HPA062051
MIMi610741 gene
neXtProtiNX_Q9HCJ0
OpenTargetsiENSG00000078687
PharmGKBiPA134880671

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFAU Eukaryota
ENOG41110AX LUCA
GeneTreeiENSGT00940000157598
HOGENOMiHOG000049171
HOVERGENiHBG062594
InParanoidiQ9HCJ0
KOiK18412
OrthoDBiEOG091G00G6
PhylomeDBiQ9HCJ0
TreeFamiTF329702

Enzyme and pathway databases

ReactomeiR-HSA-1912408 Pre-NOTCH Transcription and Translation
R-HSA-2559580 Oxidative Stress Induced Senescence
R-HSA-2559585 Oncogene Induced Senescence
R-HSA-4086398 Ca2+ pathway
R-HSA-426496 Post-transcriptional silencing by small RNAs
R-HSA-5628897 TP53 Regulates Metabolic Genes
R-HSA-5687128 MAPK6/MAPK4 signaling
R-HSA-8934593 Regulation of RUNX1 Expression and Activity
R-HSA-8936459 RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
R-HSA-8943723 Regulation of PTEN mRNA translation
R-HSA-8948700 Competing endogenous RNAs (ceRNAs) regulate PTEN translation
R-HSA-8986944 Transcriptional Regulation by MECP2
R-HSA-9018519 Estrogen-dependent gene expression
R-HSA-9022692 Regulation of MECP2 expression and activity

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TNRC6C human
EvolutionaryTraceiQ9HCJ0

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57690

Protein Ontology

More...
PROi
PR:Q9HCJ0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000078687 Expressed in 187 organ(s), highest expression level in corpus callosum
CleanExiHS_TNRC6C
ExpressionAtlasiQ9HCJ0 baseline and differential
GenevisibleiQ9HCJ0 HS

Family and domain databases

CDDicd12713 RRM_TNRC6C, 1 hit
Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR019486 Argonaute_hook_dom
IPR026805 GW182_M_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR032226 TNRC6_PABC-bd
IPR033499 TNRC6C
IPR034927 TNRC6C_RRM
IPR015940 UBA
IPR009060 UBA-like_sf
PANTHERiPTHR13020:SF9 PTHR13020:SF9, 1 hit
PfamiView protein in Pfam
PF10427 Ago_hook, 1 hit
PF12938 M_domain, 1 hit
PF00076 RRM_1, 1 hit
PF16608 TNRC6-PABC_bdg, 2 hits
PF00627 UBA, 1 hit
SMARTiView protein in SMART
SM00165 UBA, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
SSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50030 UBA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNR6C_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HCJ0
Secondary accession number(s): G3XAB8
, Q86UE5, Q8N3D8, Q96MU9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: February 20, 2007
Last modified: December 5, 2018
This is version 138 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again