Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 103 (13 Feb 2019)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

E3 SUMO-protein ligase KIAA1586

Gene

KIAA1586

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 SUMO-protein ligase; facilitates UBE2I/UBC9-mediated SUMO2 modification of target proteins (PubMed:26524493).

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein sumoylation

This protein is involved in the pathway protein sumoylation, which is part of Protein modification.1 Publication
View all proteins of this organism that are known to be involved in the pathway protein sumoylation and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00886

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 SUMO-protein ligase KIAA1586Curated (EC:2.3.2.-1 Publication)
Alternative name(s):
E3 SUMO-protein transferase KIAA1586Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000168116.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21360 KIAA1586

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HCI6

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000168116

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134963244

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KIAA1586

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172045931

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003206801 – 787E3 SUMO-protein ligase KIAA1586Add BLAST787

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki85Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki119Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki125Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9HCI6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HCI6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HCI6

PeptideAtlas

More...
PeptideAtlasi
Q9HCI6

PRoteomics IDEntifications database

More...
PRIDEi
Q9HCI6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81731
81732 [Q9HCI6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HCI6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HCI6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168116 Expressed in 162 organ(s), highest expression level in kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HCI6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HCI6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036370

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with UBE2I/UBC9 and SUMO2.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121717, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359768

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9HCI6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HCI6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 223Sufficient for E3 SUMO-protein ligase activityCuratedAdd BLAST223
Regioni30 – 37Interaction with SUMO2 1By similarity8
Regioni42 – 50Interaction with SUMO2 2By similarity9

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi38 – 41PSRPCurated4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Binds UBE2I/UBC9 and two SUMO2 molecules via its N-terminus. The most N-terminal region interacts with the SUMO2 chain that is covalently bound to the UBE2I/UBC9 active site, while the second region interacts with another SUMO2 that is non-covalently associated with the same UBE2I/UBC9 chain.By similarity1 Publication

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJ0S Eukaryota
ENOG410ZI9G LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162903

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113169

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG102546

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HCI6

Identification of Orthologs from Complete Genome Data

More...
OMAi
WHAYPVL

Database of Orthologous Groups

More...
OrthoDBi
238769at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HCI6

TreeFam database of animal gene trees

More...
TreeFami
TF343259

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012337 RNaseH-like_sf

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53098 SSF53098, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HCI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDPGSEIIE SVPPAGPEAS ESTTDENEDD IQFVSEGPSR PVLEYIDLVC
60 70 80 90 100
GDDENPSAYY SDILFPKMPK RQGDFLHFLN VKKVKTDTEN NEVSKNHCRL
110 120 130 140 150
SKAKEPHFEY IEQPIIEEKP SLSSKKEIDN LVLPDCWNEK QAFMFTEQYK
160 170 180 190 200
WLEIKEGKLG CKDCSAVRHL GSKAEKHVHV SKEWIAYLVT PNGSNKTTRQ
210 220 230 240 250
ASLRKKIREH DVSKAHGKIQ DLLKESTNDS ICNLVHKQNN KNIDATVKVF
260 270 280 290 300
NTVYSLVKHN RPLSDIEGAR ELQEKNGEVN CLNTRYSATR IAEHIAKEMK
310 320 330 340 350
MKIFKNIIEE NAKICIIIDE ASTVSKKTTL VIYLQCTIQS APAPVMLFVA
360 370 380 390 400
LKELVSTIAE CIVNTLLTTL NDCGFTNEYL KANLIAFCSD GANTILGRKS
410 420 430 440 450
GVATKLLENF PEIIIWNCLN HRLQLSLDDS ISEIKQINHL KIFIDKIYSI
460 470 480 490 500
YHQPNKNQTK LLGTVAKELE TEIIKIGRVM GPRWAACSLQ AATAVWHAYP
510 520 530 540 550
ILYMHFSHSY SGLAKRLANI NFLQDLALMI DILEEFSVLS TALQSRSTNI
560 570 580 590 600
KKAQKLIKRT IRALENLKIG TGKYESQIED LIKSDKFKDI PFNKNNKFNA
610 620 630 640 650
LPRSILLDNI IQHMNLRLLS DRNHEDIFNY FDLLEPSTWP YEEITSPWIA
660 670 680 690 700
GEKTLFHLCK ILKYEVDLND FREFVNNNIK SNNVSIPTTI YKAKKIVSTI
710 720 730 740 750
AINSAEAERG FNLMNIICTR VRNSLTIDHV SDLMTINLLG KELADWDATP
760 770 780
FVKSWSNCNH RLATDTRVRQ KSTKVFHENQ LAIWNLK
Length:787
Mass (Da):89,673
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iECBFB636C2F7959E
GO
Isoform 2 (identifier: Q9HCI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPSRPVLEYIDLVCGDDENPSAYYSD → MNFTYICKIIFQ

Show »
Length:737
Mass (Da):84,557
Checksum:i210A170F1167888E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H2N6F5H2N6_HUMAN
E3 SUMO-protein ligase KIAA1586
KIAA1586
760Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB13412 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03927675F → L. Corresponds to variant dbSNP:rs36113897Ensembl.1
Natural variantiVAR_03927781V → M. Corresponds to variant dbSNP:rs6926980Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0317401 – 62MGDPG…AYYSD → MNFTYICKIIFQ in isoform 2. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB046806 mRNA Translation: BAB13412.1 Different initiation.
AL450489 Genomic DNA No translation available.
BC041125 mRNA Translation: AAH41125.1
AK290988 mRNA Translation: BAF83677.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34480.1 [Q9HCI6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001273203.1, NM_001286274.1
NP_001273204.1, NM_001286275.1
NP_001273205.1, NM_001286276.1
NP_065982.1, NM_020931.3 [Q9HCI6-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.709521

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370733; ENSP00000359768; ENSG00000168116 [Q9HCI6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57691

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57691

UCSC genome browser

More...
UCSCi
uc003pdj.5 human [Q9HCI6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046806 mRNA Translation: BAB13412.1 Different initiation.
AL450489 Genomic DNA No translation available.
BC041125 mRNA Translation: AAH41125.1
AK290988 mRNA Translation: BAF83677.1
CCDSiCCDS34480.1 [Q9HCI6-1]
RefSeqiNP_001273203.1, NM_001286274.1
NP_001273204.1, NM_001286275.1
NP_001273205.1, NM_001286276.1
NP_065982.1, NM_020931.3 [Q9HCI6-1]
UniGeneiHs.709521

3D structure databases

ProteinModelPortaliQ9HCI6
SMRiQ9HCI6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121717, 7 interactors
STRINGi9606.ENSP00000359768

PTM databases

iPTMnetiQ9HCI6
PhosphoSitePlusiQ9HCI6

Polymorphism and mutation databases

BioMutaiKIAA1586
DMDMi172045931

Proteomic databases

jPOSTiQ9HCI6
MaxQBiQ9HCI6
PaxDbiQ9HCI6
PeptideAtlasiQ9HCI6
PRIDEiQ9HCI6
ProteomicsDBi81731
81732 [Q9HCI6-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370733; ENSP00000359768; ENSG00000168116 [Q9HCI6-1]
GeneIDi57691
KEGGihsa:57691
UCSCiuc003pdj.5 human [Q9HCI6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57691
EuPathDBiHostDB:ENSG00000168116.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KIAA1586
HGNCiHGNC:21360 KIAA1586
HPAiHPA036370
neXtProtiNX_Q9HCI6
OpenTargetsiENSG00000168116
PharmGKBiPA134963244

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJ0S Eukaryota
ENOG410ZI9G LUCA
GeneTreeiENSGT00940000162903
HOGENOMiHOG000113169
HOVERGENiHBG102546
InParanoidiQ9HCI6
OMAiWHAYPVL
OrthoDBi238769at2759
PhylomeDBiQ9HCI6
TreeFamiTF343259

Enzyme and pathway databases

UniPathwayi
UPA00886

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57691

Protein Ontology

More...
PROi
PR:Q9HCI6

Gene expression databases

BgeeiENSG00000168116 Expressed in 162 organ(s), highest expression level in kidney
ExpressionAtlasiQ9HCI6 baseline and differential
GenevisibleiQ9HCI6 HS

Family and domain databases

InterProiView protein in InterPro
IPR012337 RNaseH-like_sf
SUPFAMiSSF53098 SSF53098, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK1586_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HCI6
Secondary accession number(s): A8K4M3, Q8IW25
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: February 13, 2019
This is version 103 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again