Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (17 Jun 2020)
Sequence version 3 (07 Jul 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lateral signaling target protein 2 homolog

Gene

ZFYVE28

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negative regulator of epidermal growth factor receptor (EGFR) signaling. Acts by promoting EGFR degradation in endosomes when not monoubiquitinated.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri817 – 879FYVE-typePROSITE-ProRule annotationAdd BLAST63

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lateral signaling target protein 2 homolog
Short name:
hLst2
Alternative name(s):
Zinc finger FYVE domain-containing protein 28
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZFYVE28
Synonyms:KIAA1643, LST2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000159733.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29334 ZFYVE28

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614176 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HCC9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi87K → R: Abolishes monoubiquitination and promotes localization to early endosomes. 1 Publication1
Mutagenesisi823C → A: Abolishes binding to phosphatidylinositol 3-phosphate (PI3P). 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000159733

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134904138

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9HCC9 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZFYVE28

Domain mapping of disease mutations (DMDM)

More...
DMDMi
251757462

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000987221 – 887Lateral signaling target protein 2 homologAdd BLAST887

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki87Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei334PhosphoserineCombined sources1
Modified residuei516PhosphothreonineCombined sources1
Modified residuei586Phosphoserine; by MAP2K1 Publication1
Modified residuei870Phosphothreonine; by MAP2K1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Monoubiquitination at Lys-87 prevents binding to phosphatidylinositol 3-phosphate (PI3P) and localization to early endosome membranes.

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9HCC9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9HCC9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HCC9

PeptideAtlas

More...
PeptideAtlasi
Q9HCC9

PRoteomics IDEntifications database

More...
PRIDEi
Q9HCC9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19146
19155
20260
81671 [Q9HCC9-1]
81672 [Q9HCC9-2]
81673 [Q9HCC9-3]
81674 [Q9HCC9-4]
81675 [Q9HCC9-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HCC9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HCC9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000159733 Expressed in right hemisphere of cerebellum and 144 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HCC9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HCC9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000159733 Tissue enriched (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TRIM3.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121752, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q9HCC9, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000290974

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9HCC9 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HCC9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The FYVE-type zinc finger mediates the interaction with phosphatidylinositol 3-phosphate (PI3P) and localization to early endosome membranes when not monoubiquitinated at Lys-87.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the lst-2 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri817 – 879FYVE-typePROSITE-ProRule annotationAdd BLAST63

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1819 Eukaryota
ENOG410XNYQ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157217

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_007360_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HCC9

Identification of Orthologs from Complete Genome Data

More...
OMAi
GRHRESH

Database of Orthologous Groups

More...
OrthoDBi
451347at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HCC9

TreeFam database of animal gene trees

More...
TreeFami
TF320752

Family and domain databases

Conserved Domains Database

More...
CDDi
cd15731 FYVE_LST2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR043269 FYVE_LST2
IPR000306 Znf_FYVE
IPR017455 Znf_FYVE-rel
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01363 FYVE, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00064 FYVE, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50178 ZF_FYVE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HCC9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMNRFRKWLY KPKRSDPQLL ARFYYADEEL NQVAAELDSL DGRKDPQRCT
60 70 80 90 100
LLVSQFRSCQ DNVLNIINQI MDECIPQDRA PRDFCVKFPE EIRHDNLAGQ
110 120 130 140 150
LWFGAECLAA GSIIMNRELE SMAMRPLAKE LTRSLEDVRG ALRDQALRDL
160 170 180 190 200
NTYTEKMREA LRHFDVLFAE FELSYVSAMV PVKSPREYYV QQEVIVLFCE
210 220 230 240 250
TVERALDFGY LTQDMIDDYE PALMFSIPRL AIVCGLVVYA DGPLNLDRKV
260 270 280 290 300
EDMSELFRPF HTLLRKIRDL LQTLTEEELH TLERNLCISQ DVEFPIRADV
310 320 330 340 350
QGPAALAPAL SAPLPPEGPL SAKAKDPDAE LACSMQYDDQ ELEQLSRMVH
360 370 380 390 400
RAGDEMSSLL SPPIACQSPA HRPGAEGSPG GEASPGRPRL RSGSDEEERV
410 420 430 440 450
FFMDDVEGTA EALARPESPA GPFGWAGSTW ADPQEKGQGG PGGAAGISLP
460 470 480 490 500
ASEKEEDLSN NNLEAEGTDG ASLAGTSSCS CLDSRLHLDG WEVGADDAET
510 520 530 540 550
AEMIAHRTGG MKLSATVIFN PKSPTSLDSA VATQEAASEP VAEGMDGGPH
560 570 580 590 600
KLSTGATNCL LHSCVCCGSC GDSREDVVER LREKCSPGGV IGASYAAGLA
610 620 630 640 650
KASDRAPERQ EEAPPPSEDA SNGREPKAPT SDKCLPHTSG SQVDTASGLQ
660 670 680 690 700
GEAGVAGQQE PEARELHAGS PSAHEAPQAL SGSSSSTAGS CSSDKMGPEA
710 720 730 740 750
APAATHAAPQ ATREKIRSRF HGSHDLIHRL FVCISGVADQ LQTNYASDLR
760 770 780 790 800
SILKTLFEVM ATKPETDDKE KLRKVTQTLR SAALEDCALC QETLSSSELA
810 820 830 840 850
AKTRDGDFED PPEWVPDEAC GFCTACKAPF TVIRRKHHCR SCGKIFCSRC
860 870 880
SSHSAPLPRY GQVKPVRVCT HCYMFHVTPF YSDKAGL
Length:887
Mass (Da):96,490
Last modified:July 7, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEAF3A26A50FF26F5
GO
Isoform 2 (identifier: Q9HCC9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-234: RALDFGYLTQDMIDDYEPALMFSIPRLAIVC → S

Show »
Length:857
Mass (Da):93,017
Checksum:iBC421651F2F690EF
GO
Isoform 3 (identifier: Q9HCC9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Show »
Length:817
Mass (Da):88,144
Checksum:iE37482D0F2C1797A
GO
Isoform 4 (identifier: Q9HCC9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     204-234: RALDFGYLTQDMIDDYEPALMFSIPRLAIVC → S

Show »
Length:787
Mass (Da):84,671
Checksum:i159ED7DEFBA6AD59
GO
Isoform 5 (identifier: Q9HCC9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.

Show »
Length:773
Mass (Da):83,198
Checksum:i18C28D3588B26C8D
GO
Isoform 6 (identifier: Q9HCC9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     235-287: GLVVYADGPL...ELHTLERNLC → PLLPAHPRTR...LLRPLPELPP
     288-887: Missing.

Show »
Length:287
Mass (Da):32,724
Checksum:i282C75F9AD623A41
GO
Isoform 7 (identifier: Q9HCC9-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     14-60: Missing.
     205-219: ALDFGYLTQDMIDDY → NGKGVLKFMWNCNGP
     220-887: Missing.

Show »
Length:172
Mass (Da):20,170
Checksum:i03C358A6528554EA
GO
Isoform 8 (identifier: Q9HCC9-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     234-887: Missing.

Show »
Length:163
Mass (Da):18,907
Checksum:iF7B967E97FEEC3C4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q49AA1Q49AA1_HUMAN
Lateral-signaling target protein 2 ...
ZFYVE28
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RID3D6RID3_HUMAN
Lateral-signaling target protein 2 ...
ZFYVE28
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH53664 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB13469 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti157M → I in BAG54362 (PubMed:14702039).Curated1
Sequence conflicti306L → P in BAH14855 (PubMed:14702039).Curated1
Sequence conflicti335M → I in BAH11855 (PubMed:14702039).Curated1
Sequence conflicti341E → G in BAG54362 (PubMed:14702039).Curated1
Sequence conflicti453E → D in BAH14855 (PubMed:14702039).Curated1
Sequence conflicti679A → G in BAG54362 (PubMed:14702039).Curated1
Sequence conflicti700A → P in BAH11855 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052988603S → N1 PublicationCorresponds to variant dbSNP:rs17768776Ensembl.1
Natural variantiVAR_052989672S → P3 PublicationsCorresponds to variant dbSNP:rs661301Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0376141 – 114Missing in isoform 5. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_0376151 – 70Missing in isoform 3, isoform 4 and isoform 8. 2 PublicationsAdd BLAST70
Alternative sequenceiVSP_04609214 – 60Missing in isoform 7. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_037616204 – 234RALDF…LAIVC → S in isoform 2 and isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_046093205 – 219ALDFG…MIDDY → NGKGVLKFMWNCNGP in isoform 7. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_046094220 – 887Missing in isoform 7. 1 PublicationAdd BLAST668
Alternative sequenceiVSP_046379234 – 887Missing in isoform 8. 1 PublicationAdd BLAST654
Alternative sequenceiVSP_045805235 – 287GLVVY…ERNLC → PLLPAHPRTRAGATAHVACR MVAGSSSGALTHPPVSKQGV ISALLRPLPELPP in isoform 6. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_045806288 – 887Missing in isoform 6. 1 PublicationAdd BLAST600

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB046863 mRNA Translation: BAB13469.1 Different initiation.
AK126692 mRNA Translation: BAG54362.1
AK293775 mRNA Translation: BAH11593.1
AK294710 mRNA Translation: BAH11855.1
AK294874 mRNA Translation: BAH11908.1
AK316484 mRNA Translation: BAH14855.1
AL158068 Genomic DNA No translation available.
AL645924 Genomic DNA No translation available.
BC032605 mRNA No translation available.
BC035793 mRNA No translation available.
BC053664 mRNA Translation: AAH53664.1 Different initiation.
BC137309 mRNA Translation: AAI37310.1
BC137310 mRNA Translation: AAI37311.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33942.1 [Q9HCC9-1]
CCDS54708.1 [Q9HCC9-3]
CCDS54709.1 [Q9HCC9-8]
CCDS54710.1 [Q9HCC9-7]
CCDS54711.1 [Q9HCC9-2]
CCDS54712.1 [Q9HCC9-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001166127.1, NM_001172656.1 [Q9HCC9-2]
NP_001166128.1, NM_001172657.1 [Q9HCC9-6]
NP_001166129.1, NM_001172658.1 [Q9HCC9-7]
NP_001166130.1, NM_001172659.1 [Q9HCC9-3]
NP_001166131.1, NM_001172660.1 [Q9HCC9-8]
NP_066023.2, NM_020972.2 [Q9HCC9-1]
XP_016863994.1, XM_017008505.1 [Q9HCC9-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000290974; ENSP00000290974; ENSG00000159733 [Q9HCC9-1]
ENST00000503000; ENSP00000423694; ENSG00000159733 [Q9HCC9-6]
ENST00000509171; ENSP00000422638; ENSG00000159733 [Q9HCC9-7]
ENST00000511071; ENSP00000425706; ENSG00000159733 [Q9HCC9-2]
ENST00000515169; ENSP00000425766; ENSG00000159733 [Q9HCC9-8]
ENST00000515312; ENSP00000426299; ENSG00000159733 [Q9HCC9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57732

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57732

UCSC genome browser

More...
UCSCi
uc003gex.3 human [Q9HCC9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046863 mRNA Translation: BAB13469.1 Different initiation.
AK126692 mRNA Translation: BAG54362.1
AK293775 mRNA Translation: BAH11593.1
AK294710 mRNA Translation: BAH11855.1
AK294874 mRNA Translation: BAH11908.1
AK316484 mRNA Translation: BAH14855.1
AL158068 Genomic DNA No translation available.
AL645924 Genomic DNA No translation available.
BC032605 mRNA No translation available.
BC035793 mRNA No translation available.
BC053664 mRNA Translation: AAH53664.1 Different initiation.
BC137309 mRNA Translation: AAI37310.1
BC137310 mRNA Translation: AAI37311.1
CCDSiCCDS33942.1 [Q9HCC9-1]
CCDS54708.1 [Q9HCC9-3]
CCDS54709.1 [Q9HCC9-8]
CCDS54710.1 [Q9HCC9-7]
CCDS54711.1 [Q9HCC9-2]
CCDS54712.1 [Q9HCC9-6]
RefSeqiNP_001166127.1, NM_001172656.1 [Q9HCC9-2]
NP_001166128.1, NM_001172657.1 [Q9HCC9-6]
NP_001166129.1, NM_001172658.1 [Q9HCC9-7]
NP_001166130.1, NM_001172659.1 [Q9HCC9-3]
NP_001166131.1, NM_001172660.1 [Q9HCC9-8]
NP_066023.2, NM_020972.2 [Q9HCC9-1]
XP_016863994.1, XM_017008505.1 [Q9HCC9-5]

3D structure databases

SMRiQ9HCC9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi121752, 8 interactors
IntActiQ9HCC9, 1 interactor
STRINGi9606.ENSP00000290974

PTM databases

iPTMnetiQ9HCC9
PhosphoSitePlusiQ9HCC9

Polymorphism and mutation databases

BioMutaiZFYVE28
DMDMi251757462

Proteomic databases

jPOSTiQ9HCC9
MassIVEiQ9HCC9
PaxDbiQ9HCC9
PeptideAtlasiQ9HCC9
PRIDEiQ9HCC9
ProteomicsDBi19146
19155
20260
81671 [Q9HCC9-1]
81672 [Q9HCC9-2]
81673 [Q9HCC9-3]
81674 [Q9HCC9-4]
81675 [Q9HCC9-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22351 91 antibodies

Genome annotation databases

EnsembliENST00000290974; ENSP00000290974; ENSG00000159733 [Q9HCC9-1]
ENST00000503000; ENSP00000423694; ENSG00000159733 [Q9HCC9-6]
ENST00000509171; ENSP00000422638; ENSG00000159733 [Q9HCC9-7]
ENST00000511071; ENSP00000425706; ENSG00000159733 [Q9HCC9-2]
ENST00000515169; ENSP00000425766; ENSG00000159733 [Q9HCC9-8]
ENST00000515312; ENSP00000426299; ENSG00000159733 [Q9HCC9-3]
GeneIDi57732
KEGGihsa:57732
UCSCiuc003gex.3 human [Q9HCC9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57732
EuPathDBiHostDB:ENSG00000159733.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZFYVE28
HGNCiHGNC:29334 ZFYVE28
HPAiENSG00000159733 Tissue enriched (brain)
MIMi614176 gene
neXtProtiNX_Q9HCC9
OpenTargetsiENSG00000159733
PharmGKBiPA134904138

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1819 Eukaryota
ENOG410XNYQ LUCA
GeneTreeiENSGT00940000157217
HOGENOMiCLU_007360_1_0_1
InParanoidiQ9HCC9
OMAiGRHRESH
OrthoDBi451347at2759
PhylomeDBiQ9HCC9
TreeFamiTF320752

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
57732 4 hits in 793 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZFYVE28 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57732
PharosiQ9HCC9 Tbio

Protein Ontology

More...
PROi
PR:Q9HCC9
RNActiQ9HCC9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000159733 Expressed in right hemisphere of cerebellum and 144 other tissues
ExpressionAtlasiQ9HCC9 baseline and differential
GenevisibleiQ9HCC9 HS

Family and domain databases

CDDicd15731 FYVE_LST2, 1 hit
Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR043269 FYVE_LST2
IPR000306 Znf_FYVE
IPR017455 Znf_FYVE-rel
IPR011011 Znf_FYVE_PHD
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF01363 FYVE, 1 hit
SMARTiView protein in SMART
SM00064 FYVE, 1 hit
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS50178 ZF_FYVE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLST2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HCC9
Secondary accession number(s): B2RP83
, B3KX50, B7Z1Q7, B7Z2G9, B7Z2M2, B7ZB19, E9PB54, E9PB64, E9PG77, Q7Z6J3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: July 7, 2009
Last modified: June 17, 2020
This is version 137 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again