Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9HC98 (NEK6_HUMAN)

Entry version 172 (08 May 2019)
Sequence version 2 (03 Oct 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Serine/threonine-protein kinase Nek6

Gene

NEK6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protein kinase which plays an important role in mitotic cell cycle progression (PubMed:14563848). Required for chromosome segregation at metaphase-anaphase transition, robust mitotic spindle formation and cytokinesis (PubMed:19414596). Phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histones H1 and H3 (PubMed:12054534, PubMed:20873783). Phosphorylates KIF11 to promote mitotic spindle formation (PubMed:19001501). Involved in G2/M phase cell cycle arrest induced by DNA damage (PubMed:18728393). Inhibition of activity results in apoptosis. May contribute to tumorigenesis by suppressing p53/TP53-induced cancer cell senescence (PubMed:21099361).7 Publications

Caution

A paper showing a role in tumorigenesis has been retracted due to panel duplication in several figures.1 Publication1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Binding to NEK9 stimulates its activity by releasing the autoinhibitory function of Tyr-108.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei74ATPPROSITE-ProRule annotation1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei108Autoinhibitory1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei172Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi51 – 59ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processApoptosis, Cell cycle, Cell division, Chromosome partition, Mitosis
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2980767 Activation of NIMA Kinases NEK9, NEK6, NEK7
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9HC98

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9HC98

Protein family/group databases

Transport Classification Database

More...TCDBi		1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase Nek6 (EC:2.7.11.1)
Alternative name(s):
Never in mitosis A-related kinase 6
Short name:
NimA-related protein kinase 6
Protein kinase SID6-1512
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NEK6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:7749 NEK6

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604884 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9HC98

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi74K → M: Loss of autophosphorylation and of kinase activity and induction of apoptosis; when associated with M-75. 2 Publications1
Mutagenesisi75K → M: Loss of autophosphorylation and of kinase activity and induction of apoptosis; when associated with M-74. 2 Publications1
Mutagenesisi108Y → A: Increase in catalytic activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		10783

Open Targets

More...OpenTargetsi		ENSG00000119408

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA31550

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4309

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NEK6

Domain mapping of disease mutations (DMDM)

More...DMDMi		37537993

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000864271 – 313Serine/threonine-protein kinase Nek6Add BLAST313

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei37Phosphoserine1 Publication1
Modified residuei202Phosphothreonine1 Publication1
Modified residuei206Phosphoserine; by NEK9Combined sources2 Publications1
Modified residuei210Phosphothreonine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autophosphorylated. Phosphorylation at Ser-206 is required for its activation. Phosphorylated upon IR or UV-induced DNA damage. Phosphorylated by CHEK1 and CHEK2. Interaction with APBB1 down-regulates phosphorylation at Thr-210.4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9HC98

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9HC98

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9HC98

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9HC98

PeptideAtlas

More...PeptideAtlasi		Q9HC98

PRoteomics IDEntifications database

More...PRIDEi		Q9HC98

ProteomicsDB human proteome resource

More...ProteomicsDBi		81659
81660 [Q9HC98-2]
81661 [Q9HC98-3]
81662 [Q9HC98-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9HC98

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9HC98

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous, with highest expression in heart and skeletal muscle.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated during the M phase of cell cycle progression. Down-regulated in both replicative and premature senescence of cancer cells.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000119408 Expressed in 176 organ(s), highest expression level in pigmented layer of retina

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9HC98 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9HC98 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB045993
HPA056828

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with STAT3 and RPS6KB1 (By similarity). Interacts with NEK9, predominantly in mitosis. Interacts with KIF11 (via C-terminus). Interacts with APBB1 (via WW domain). Interacts with ANKRA2, ATF4, ARHGAP33, CDC42, CIR1, PRAM1, PTN, PRDX3, PIN1, RAD26L, RBBP6, RPS7 and TRIP4.By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		116000, 69 interactors

Protein interaction database and analysis system

More...IntActi		Q9HC98, 95 interactors

Molecular INTeraction database

More...MINTi		Q9HC98

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000362702

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9HC98

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9HC98

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini45 – 310Protein kinasePROSITE-ProRule annotationAdd BLAST266

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 44Interaction with ARHGAP33, ANKRA2, CDC42, PRDX3, RAD26L, RBBP6, RPS7 and TRIP41 PublicationAdd BLAST44
Regioni267 – 270Interaction with APBB11 Publication4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Displays an autoinhibited conformation: Tyr-108 side chain points into the active site, interacts with the activation loop, and blocks the alphaC helix. The autoinhibitory conformation is released upon binding with NEK9.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. NEK Ser/Thr protein kinase family. NIMA subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0591 Eukaryota
ENOG410XNQP LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159990

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9HC98

KEGG Orthology (KO)

More...KOi		K20875

Identification of Orthologs from Complete Genome Data

More...OMAi		HQIAKQM

Database of Orthologous Groups

More...OrthoDBi		1290401at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9HC98

TreeFam database of animal gene trees

More...TreeFami		TF101021

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00069 Pkinase, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00109 TYRKINASE

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HC98-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGQPGHMPH GGSSNNLCHT LGPVHPPDPQ RHPNTLSFRC SLADFQIEKK 
        60         70         80         90        100
IGRGQFSEVY KATCLLDRKT VALKKVQIFE MMDAKARQDC VKEIGLLKQL 
       110        120        130        140        150
NHPNIIKYLD SFIEDNELNI VLELADAGDL SQMIKYFKKQ KRLIPERTVW 
       160        170        180        190        200
KYFVQLCSAV EHMHSRRVMH RDIKPANVFI TATGVVKLGD LGLGRFFSSE 
       210        220        230        240        250
TTAAHSLVGT PYYMSPERIH ENGYNFKSDI WSLGCLLYEM AALQSPFYGD 
       260        270        280        290        300
KMNLFSLCQK IEQCDYPPLP GEHYSEKLRE LVSMCICPDP HQRPDIGYVH 
       310 
QVAKQMHIWM SST
Length:313
Mass (Da):35,714
Last modified:October 3, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB898DC57407A8C16
GO
Isoform 2 (identifier: Q9HC98-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPRREVCWEAAHFRQEEQSLPRPRVRALVRLACRM

Show »
Length:347
Mass (Da):39,844
Checksum:i2CA3B83E91024B8A
GO
Isoform 3 (identifier: Q9HC98-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGRRRPAPFRALVRLACRM

Show »
Length:331
Mass (Da):37,823
Checksum:iDF83ECFFE6F5B2F6
GO
Isoform 4 (identifier: Q9HC98-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEATGWDSRCSPGTQVRALVRLACRM

Show »
Length:338
Mass (Da):38,460
Checksum:i2B680899AE6D5765
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5TBG1Q5TBG1_HUMAN
Serine/threonine-protein kinase Nek...
NEK6
207Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TBG7Q5TBG7_HUMAN
Serine/threonine-protein kinase Nek...
NEK6
219Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TBH2Q5TBH2_HUMAN
Serine/threonine-protein kinase Nek...
NEK6
220Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TBH1Q5TBH1_HUMAN
Serine/threonine-protein kinase Nek...
NEK6
222Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TBG2Q5TBG2_HUMAN
Serine/threonine-protein kinase Nek...
NEK6
171Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TBG4Q5TBG4_HUMAN
Serine/threonine-protein kinase Nek...
NEK6
194Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5TBH0Q5TBH0_HUMAN
Serine/threonine-protein kinase Nek...
NEK6
200Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG13417 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part.Curated
The sequence AAH00101 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH04174 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH04209 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA85045 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti88Q → W in CAG33372 (Ref. 7) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0417981M → MPRREVCWEAAHFRQEEQSL PRPRVRALVRLACRM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0417991M → MGRRRPAPFRALVRLACRM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0418001M → MEATGWDSRCSPGTQVRALV RLACRM in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF087909 mRNA Translation: AAG13417.1 Sequence problems.
AB026289 mRNA Translation: BAA85045.1 Different initiation.
AK294614 mRNA Translation: BAH11825.1
AK313071 mRNA Translation: BAG35899.1
AL162724 Genomic DNA No translation available.
AL137846 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87579.1
CH471090 Genomic DNA Translation: EAW87581.1
BC000101 mRNA Translation: AAH00101.2 Different initiation.
BC004174 mRNA Translation: AAH04174.2 Different initiation.
BC004209 mRNA Translation: AAH04209.2 Different initiation.
BC012761 mRNA Translation: AAH12761.1
CR457091 mRNA Translation: CAG33372.1
CR542222 mRNA Translation: CAG47018.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS48015.1 [Q9HC98-2]
CCDS55338.1 [Q9HC98-3]
CCDS55339.1 [Q9HC98-4]
CCDS6854.1 [Q9HC98-1]

Protein sequence database of the Protein Information Resource

More...PIRi		JC7838

NCBI Reference Sequences

More...RefSeqi		NP_001138473.1, NM_001145001.2 [Q9HC98-2]
NP_001159639.1, NM_001166167.1 [Q9HC98-3]
NP_001159640.1, NM_001166168.1 [Q9HC98-1]
NP_001159641.1, NM_001166169.1 [Q9HC98-4]
NP_001159642.1, NM_001166170.1 [Q9HC98-1]
NP_001159643.1, NM_001166171.1 [Q9HC98-2]
NP_055212.2, NM_014397.5 [Q9HC98-1]
XP_005251721.1, XM_005251664.1 [Q9HC98-1]
XP_006716999.1, XM_006716936.2 [Q9HC98-1]
XP_016869706.1, XM_017014217.1 [Q9HC98-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000320246; ENSP00000319734; ENSG00000119408 [Q9HC98-1]
ENST00000373600; ENSP00000362702; ENSG00000119408 [Q9HC98-2]
ENST00000373603; ENSP00000362705; ENSG00000119408 [Q9HC98-1]
ENST00000394199; ENSP00000377749; ENSG00000119408 [Q9HC98-2]
ENST00000539416; ENSP00000439651; ENSG00000119408 [Q9HC98-4]
ENST00000540326; ENSP00000441469; ENSG00000119408 [Q9HC98-3]
ENST00000545174; ENSP00000442636; ENSG00000119408 [Q9HC98-1]
ENST00000546191; ENSP00000441426; ENSG00000119408 [Q9HC98-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10783

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10783

UCSC genome browser

More...UCSCi		uc004bof.4 human [Q9HC98-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087909 mRNA Translation: AAG13417.1 Sequence problems.
AB026289 mRNA Translation: BAA85045.1 Different initiation.
AK294614 mRNA Translation: BAH11825.1
AK313071 mRNA Translation: BAG35899.1
AL162724 Genomic DNA No translation available.
AL137846 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87579.1
CH471090 Genomic DNA Translation: EAW87581.1
BC000101 mRNA Translation: AAH00101.2 Different initiation.
BC004174 mRNA Translation: AAH04174.2 Different initiation.
BC004209 mRNA Translation: AAH04209.2 Different initiation.
BC012761 mRNA Translation: AAH12761.1
CR457091 mRNA Translation: CAG33372.1
CR542222 mRNA Translation: CAG47018.1
CCDSiCCDS48015.1 [Q9HC98-2]
CCDS55338.1 [Q9HC98-3]
CCDS55339.1 [Q9HC98-4]
CCDS6854.1 [Q9HC98-1]
PIRiJC7838
RefSeqiNP_001138473.1, NM_001145001.2 [Q9HC98-2]
NP_001159639.1, NM_001166167.1 [Q9HC98-3]
NP_001159640.1, NM_001166168.1 [Q9HC98-1]
NP_001159641.1, NM_001166169.1 [Q9HC98-4]
NP_001159642.1, NM_001166170.1 [Q9HC98-1]
NP_001159643.1, NM_001166171.1 [Q9HC98-2]
NP_055212.2, NM_014397.5 [Q9HC98-1]
XP_005251721.1, XM_005251664.1 [Q9HC98-1]
XP_006716999.1, XM_006716936.2 [Q9HC98-1]
XP_016869706.1, XM_017014217.1 [Q9HC98-2]

3D structure databases

SMRiQ9HC98
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116000, 69 interactors
IntActiQ9HC98, 95 interactors
MINTiQ9HC98
STRINGi9606.ENSP00000362702

Chemistry databases

BindingDBiQ9HC98
ChEMBLiCHEMBL4309

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

PTM databases

iPTMnetiQ9HC98
PhosphoSitePlusiQ9HC98

Polymorphism and mutation databases

BioMutaiNEK6
DMDMi37537993

Proteomic databases

EPDiQ9HC98
jPOSTiQ9HC98
MaxQBiQ9HC98
PaxDbiQ9HC98
PeptideAtlasiQ9HC98
PRIDEiQ9HC98
ProteomicsDBi81659
81660 [Q9HC98-2]
81661 [Q9HC98-3]
81662 [Q9HC98-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		10783
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000320246; ENSP00000319734; ENSG00000119408 [Q9HC98-1]
ENST00000373600; ENSP00000362702; ENSG00000119408 [Q9HC98-2]
ENST00000373603; ENSP00000362705; ENSG00000119408 [Q9HC98-1]
ENST00000394199; ENSP00000377749; ENSG00000119408 [Q9HC98-2]
ENST00000539416; ENSP00000439651; ENSG00000119408 [Q9HC98-4]
ENST00000540326; ENSP00000441469; ENSG00000119408 [Q9HC98-3]
ENST00000545174; ENSP00000442636; ENSG00000119408 [Q9HC98-1]
ENST00000546191; ENSP00000441426; ENSG00000119408 [Q9HC98-1]
GeneIDi10783
KEGGihsa:10783
UCSCiuc004bof.4 human [Q9HC98-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10783
DisGeNETi10783

GeneCards: human genes, protein and diseases

More...GeneCardsi		NEK6
HGNCiHGNC:7749 NEK6
HPAiCAB045993
HPA056828
MIMi604884 gene
neXtProtiNX_Q9HC98
OpenTargetsiENSG00000119408
PharmGKBiPA31550

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0591 Eukaryota
ENOG410XNQP LUCA
GeneTreeiENSGT00940000159990
InParanoidiQ9HC98
KOiK20875
OMAiHQIAKQM
OrthoDBi1290401at2759
PhylomeDBiQ9HC98
TreeFamiTF101021

Enzyme and pathway databases

ReactomeiR-HSA-2980767 Activation of NIMA Kinases NEK9, NEK6, NEK7
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
SignaLinkiQ9HC98
SIGNORiQ9HC98

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NEK6 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		NEK6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10783

Protein Ontology

More...PROi		PR:Q9HC98

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000119408 Expressed in 176 organ(s), highest expression level in pigmented layer of retina
ExpressionAtlasiQ9HC98 baseline and differential
GenevisibleiQ9HC98 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
PRINTSiPR00109 TYRKINASE
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNEK6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HC98
Secondary accession number(s): B7Z2D9
, Q5TBG3, Q5TBG9, Q6FG86, Q6IAR3, Q96E83, Q9ULX2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: October 3, 2003
Last modified: May 8, 2019
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again