Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9HC97 (GPR35_HUMAN)

Entry version 156 (10 Feb 2021)
Sequence version 4 (21 Jun 2005)
Previous versions | rss
Add a publicationFeedback
Protein

G-protein coupled receptor 35

Gene

GPR35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9HC97

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-373076, Class A/1 (Rhodopsin-like receptors)

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q9HC97

Protein family/group databases

Transport Classification Database

More...TCDBi		9.A.14.13.8, the g-protein-coupled receptor (gpcr) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
G-protein coupled receptor 35
Alternative name(s):
Kynurenic acid receptor
Short name:
KYNA receptor
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GPR35
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:4492, GPR35

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602646, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9HC97

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000178623.11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 24ExtracellularSequence analysisAdd BLAST24
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei25 – 45Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini46 – 56CytoplasmicSequence analysisAdd BLAST11
Transmembranei57 – 77Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini78 – 90ExtracellularSequence analysisAdd BLAST13
Transmembranei91 – 112Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini113 – 135CytoplasmicSequence analysisAdd BLAST23
Transmembranei136 – 156Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini157 – 174ExtracellularSequence analysisAdd BLAST18
Transmembranei175 – 195Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini196 – 218CytoplasmicSequence analysisAdd BLAST23
Transmembranei219 – 239Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini240 – 258ExtracellularSequence analysisAdd BLAST19
Transmembranei259 – 279Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini280 – 309CytoplasmicSequence analysisAdd BLAST30

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		2859

MalaCards human disease database

More...MalaCardsi		GPR35

Open Targets

More...OpenTargetsi		ENSG00000178623

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		171, Primary sclerosing cholangitis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28880

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9HC97, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL1293267

Drug and drug target database

More...DrugBanki		DB00695, Furosemide
DB11937, Kynurenic Acid
DB11156, Pyrantel

DrugCentral

More...DrugCentrali		Q9HC97

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		102

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GPR35

Domain mapping of disease mutations (DMDM)

More...DMDMi		68068087

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000695631 – 309G-protein coupled receptor 35Add BLAST309

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi2N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi89 ↔ 162PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9HC97

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9HC97

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9HC97

PeptideAtlas

More...PeptideAtlasi		Q9HC97

PRoteomics IDEntifications database

More...PRIDEi		Q9HC97

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		81658 [Q9HC97-1]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q9HC97, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9HC97

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9HC97

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in immune and gastrointestinal tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000178623, Expressed in mucosa of transverse colon and 126 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9HC97, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000178623, Tissue enriched (intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		109117, 7 interactors

Protein interaction database and analysis system

More...IntActi		Q9HC97, 64 interactors

Molecular INTeraction database

More...MINTi		Q9HC97

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000411788

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q9HC97

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9HC97, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S0QN, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT01010000222244

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_009579_8_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9HC97

Identification of Orthologs from Complete Genome Data

More...OMAi		DANCCLD

Database of Orthologous Groups

More...OrthoDBi		966250at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9HC97

TreeFam database of animal gene trees

More...TreeFami		TF335578

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000276, GPCR_Rhodpsn
IPR017452, GPCR_Rhodpsn_7TM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00001, 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00237, GPCRRHODOPSN

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00237, G_PROTEIN_RECEP_F1_1, 1 hit
PS50262, G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9HC97-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGTYNTCGS SDLTWPPAIK LGFYAYLGVL LVLGLLLNSL ALWVFCCRMQ 
        60         70         80         90        100
QWTETRIYMT NLAVADLCLL CTLPFVLHSL RDTSDTPLCQ LSQGIYLTNR 
       110        120        130        140        150
YMSISLVTAI AVDRYVAVRH PLRARGLRSP RQAAAVCAVL WVLVIGSLVA 
       160        170        180        190        200
RWLLGIQEGG FCFRSTRHNF NSMAFPLLGF YLPLAVVVFC SLKVVTALAQ 
       210        220        230        240        250
RPPTDVGQAE ATRKAARMVW ANLLVFVVCF LPLHVGLTVR LAVGWNACAL 
       260        270        280        290        300
LETIRRALYI TSKLSDANCC LDAICYYYMA KEFQEASALA VAPSAKAHKS 

QDSLCVTLA
Length:309
Mass (Da):34,072
Last modified:June 21, 2005 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i97734FB7231B26F0
GO
Isoform 2 (identifier: Q9HC97-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGSRAVPTPHRGSEELLKYMLHSPCVSLTM

Show »
Length:340
Mass (Da):37,452
Checksum:i197A24A76F52BEF8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti174A → R in AAC52028 (PubMed:9479505).Curated1
Isoform 2 (identifier: Q9HC97-2)
Sequence conflicti13R → H in AK172786 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01360125A → T1 PublicationCorresponds to variant dbSNP:rs35146537Ensembl.1
Natural variantiVAR_01360229V → I1 PublicationCorresponds to variant dbSNP:rs139197368Ensembl.1
Natural variantiVAR_03346776V → M. Corresponds to variant dbSNP:rs13387859Ensembl.1
Natural variantiVAR_013603108T → M1 PublicationCorresponds to variant dbSNP:rs3749171Ensembl.1
Natural variantiVAR_013604125R → S1 PublicationCorresponds to variant dbSNP:rs34778053Ensembl.1
Natural variantiVAR_013605253T → M1 PublicationCorresponds to variant dbSNP:rs12468485Ensembl.1
Natural variantiVAR_013606294S → R4 PublicationsCorresponds to variant dbSNP:rs3749172Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0458711M → MLSGSRAVPTPHRGSEELLK YMLHSPCVSLTM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF027957 Genomic DNA Translation: AAC52028.1
AF089087 mRNA Translation: AAG17965.1
AY275467 Genomic DNA Translation: AAP32299.1
AK172786 mRNA No translation available.
CR541765 mRNA Translation: CAG46564.1
AC124862 Genomic DNA Translation: AAX88945.1
BC095500 mRNA Translation: AAH95500.1
BC117453 mRNA Translation: AAI17454.2
BC117455 mRNA Translation: AAI17456.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2541.1 [Q9HC97-1]
CCDS56174.1 [Q9HC97-2]

NCBI Reference Sequences

More...RefSeqi		NP_001182310.1, NM_001195381.1 [Q9HC97-2]
NP_001182311.1, NM_001195382.1 [Q9HC97-2]
NP_005292.2, NM_005301.3 [Q9HC97-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000319838; ENSP00000322731; ENSG00000178623 [Q9HC97-1]
ENST00000403859; ENSP00000385140; ENSG00000178623 [Q9HC97-1]
ENST00000407714; ENSP00000384263; ENSG00000178623 [Q9HC97-1]
ENST00000430267; ENSP00000411788; ENSG00000178623 [Q9HC97-2]
ENST00000438013; ENSP00000415890; ENSG00000178623 [Q9HC97-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2859

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2859

UCSC genome browser

More...UCSCi		uc002vzs.4, human [Q9HC97-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027957 Genomic DNA Translation: AAC52028.1
AF089087 mRNA Translation: AAG17965.1
AY275467 Genomic DNA Translation: AAP32299.1
AK172786 mRNA No translation available.
CR541765 mRNA Translation: CAG46564.1
AC124862 Genomic DNA Translation: AAX88945.1
BC095500 mRNA Translation: AAH95500.1
BC117453 mRNA Translation: AAI17454.2
BC117455 mRNA Translation: AAI17456.2
CCDSiCCDS2541.1 [Q9HC97-1]
CCDS56174.1 [Q9HC97-2]
RefSeqiNP_001182310.1, NM_001195381.1 [Q9HC97-2]
NP_001182311.1, NM_001195382.1 [Q9HC97-2]
NP_005292.2, NM_005301.3 [Q9HC97-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi109117, 7 interactors
IntActiQ9HC97, 64 interactors
MINTiQ9HC97
STRINGi9606.ENSP00000411788

Chemistry databases

BindingDBiQ9HC97
ChEMBLiCHEMBL1293267
DrugBankiDB00695, Furosemide
DB11937, Kynurenic Acid
DB11156, Pyrantel
DrugCentraliQ9HC97
GuidetoPHARMACOLOGYi102

Protein family/group databases

TCDBi9.A.14.13.8, the g-protein-coupled receptor (gpcr) family

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

GlyGeniQ9HC97, 1 site
iPTMnetiQ9HC97
PhosphoSitePlusiQ9HC97

Genetic variation databases

BioMutaiGPR35
DMDMi68068087

Proteomic databases

jPOSTiQ9HC97
MassIVEiQ9HC97
PaxDbiQ9HC97
PeptideAtlasiQ9HC97
PRIDEiQ9HC97
ProteomicsDBi81658 [Q9HC97-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34526, 222 antibodies

The DNASU plasmid repository

More...DNASUi		2859

Genome annotation databases

EnsembliENST00000319838; ENSP00000322731; ENSG00000178623 [Q9HC97-1]
ENST00000403859; ENSP00000385140; ENSG00000178623 [Q9HC97-1]
ENST00000407714; ENSP00000384263; ENSG00000178623 [Q9HC97-1]
ENST00000430267; ENSP00000411788; ENSG00000178623 [Q9HC97-2]
ENST00000438013; ENSP00000415890; ENSG00000178623 [Q9HC97-1]
GeneIDi2859
KEGGihsa:2859
UCSCiuc002vzs.4, human [Q9HC97-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2859
DisGeNETi2859

GeneCards: human genes, protein and diseases

More...GeneCardsi		GPR35
HGNCiHGNC:4492, GPR35
HPAiENSG00000178623, Tissue enriched (intestine)
MalaCardsiGPR35
MIMi602646, gene
neXtProtiNX_Q9HC97
OpenTargetsiENSG00000178623
Orphaneti171, Primary sclerosing cholangitis
PharmGKBiPA28880
VEuPathDBiHostDB:ENSG00000178623.11

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S0QN, Eukaryota
GeneTreeiENSGT01010000222244
HOGENOMiCLU_009579_8_2_1
InParanoidiQ9HC97
OMAiDANCCLD
OrthoDBi966250at2759
PhylomeDBiQ9HC97
TreeFamiTF335578

Enzyme and pathway databases

PathwayCommonsiQ9HC97
ReactomeiR-HSA-373076, Class A/1 (Rhodopsin-like receptors)
SIGNORiQ9HC97

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2859, 6 hits in 876 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		GPR35, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2859
PharosiQ9HC97, Tchem

Protein Ontology

More...PROi		PR:Q9HC97
RNActiQ9HC97, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000178623, Expressed in mucosa of transverse colon and 126 other tissues
GenevisibleiQ9HC97, HS

Family and domain databases

InterProiView protein in InterPro
IPR000276, GPCR_Rhodpsn
IPR017452, GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001, 7tm_1, 1 hit
PRINTSiPR00237, GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237, G_PROTEIN_RECEP_F1_1, 1 hit
PS50262, G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGPR35_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HC97
Secondary accession number(s): J3KR30
, O43495, Q17R58, Q4VBN5, Q4ZFV2, Q6FHI8, Q86UH4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 14, 2001
Last sequence update: June 21, 2005
Last modified: February 10, 2021
This is version 156 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again