Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

G-protein coupled receptor 35

Gene

GPR35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.1 Publication

GO - Molecular functioni

  • C-X-C chemokine receptor activity Source: UniProtKB
  • G protein-coupled receptor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

ReactomeiR-HSA-373076 Class A/1 (Rhodopsin-like receptors)

Protein family/group databases

TCDBi9.A.14.13.8 the g-protein-coupled receptor (gpcr) family

Names & Taxonomyi

Protein namesi
Recommended name:
G-protein coupled receptor 35
Alternative name(s):
Kynurenic acid receptor
Short name:
KYNA receptor
Gene namesi
Name:GPR35
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000178623.11
HGNCiHGNC:4492 GPR35
MIMi602646 gene
neXtProtiNX_Q9HC97

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 24ExtracellularSequence analysisAdd BLAST24
Transmembranei25 – 45Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini46 – 56CytoplasmicSequence analysisAdd BLAST11
Transmembranei57 – 77Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini78 – 90ExtracellularSequence analysisAdd BLAST13
Transmembranei91 – 112Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini113 – 135CytoplasmicSequence analysisAdd BLAST23
Transmembranei136 – 156Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini157 – 174ExtracellularSequence analysisAdd BLAST18
Transmembranei175 – 195Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini196 – 218CytoplasmicSequence analysisAdd BLAST23
Transmembranei219 – 239Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini240 – 258ExtracellularSequence analysisAdd BLAST19
Transmembranei259 – 279Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini280 – 309CytoplasmicSequence analysisAdd BLAST30

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi2859
MalaCardsiGPR35
OpenTargetsiENSG00000178623
Orphaneti171 Primary sclerosing cholangitis
PharmGKBiPA28880

Chemistry databases

ChEMBLiCHEMBL1293267
GuidetoPHARMACOLOGYi102

Polymorphism and mutation databases

BioMutaiGPR35
DMDMi68068087

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000695631 – 309G-protein coupled receptor 35Add BLAST309

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi2N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi89 ↔ 162PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9HC97
PeptideAtlasiQ9HC97
PRIDEiQ9HC97
ProteomicsDBi81658

PTM databases

iPTMnetiQ9HC97
PhosphoSitePlusiQ9HC97

Expressioni

Tissue specificityi

Predominantly expressed in immune and gastrointestinal tissues.1 Publication

Gene expression databases

BgeeiENSG00000178623 Expressed in 105 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_GPR35
GenevisibleiQ9HC97 HS

Interactioni

Protein-protein interaction databases

BioGridi109117, 7 interactors
STRINGi9606.ENSP00000415890

Chemistry databases

BindingDBiQ9HC97

Structurei

3D structure databases

ProteinModelPortaliQ9HC97
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IE2J Eukaryota
ENOG4111JSA LUCA
GeneTreeiENSGT00920000149026
HOVERGENiHBG101122
InParanoidiQ9HC97
KOiK04276
OMAiDANCCLD
OrthoDBiEOG091G0JBB
PhylomeDBiQ9HC97
TreeFamiTF335578

Family and domain databases

InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9HC97-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGTYNTCGS SDLTWPPAIK LGFYAYLGVL LVLGLLLNSL ALWVFCCRMQ
60 70 80 90 100
QWTETRIYMT NLAVADLCLL CTLPFVLHSL RDTSDTPLCQ LSQGIYLTNR
110 120 130 140 150
YMSISLVTAI AVDRYVAVRH PLRARGLRSP RQAAAVCAVL WVLVIGSLVA
160 170 180 190 200
RWLLGIQEGG FCFRSTRHNF NSMAFPLLGF YLPLAVVVFC SLKVVTALAQ
210 220 230 240 250
RPPTDVGQAE ATRKAARMVW ANLLVFVVCF LPLHVGLTVR LAVGWNACAL
260 270 280 290 300
LETIRRALYI TSKLSDANCC LDAICYYYMA KEFQEASALA VAPSAKAHKS

QDSLCVTLA
Length:309
Mass (Da):34,072
Last modified:June 21, 2005 - v4
Checksum:i97734FB7231B26F0
GO
Isoform 2 (identifier: Q9HC97-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSGSRAVPTPHRGSEELLKYMLHSPCVSLTM

Note: No experimental confirmation available.Curated
Show »
Length:340
Mass (Da):37,452
Checksum:i197A24A76F52BEF8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti174A → R in AAC52028 (PubMed:9479505).Curated1
Isoform 2 (identifier: Q9HC97-2)
Sequence conflicti13R → H in AK172786 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01360125A → T1 PublicationCorresponds to variant dbSNP:rs35146537Ensembl.1
Natural variantiVAR_01360229V → I1 PublicationCorresponds to variant dbSNP:rs139197368Ensembl.1
Natural variantiVAR_03346776V → M. Corresponds to variant dbSNP:rs13387859Ensembl.1
Natural variantiVAR_013603108T → M1 PublicationCorresponds to variant dbSNP:rs3749171Ensembl.1
Natural variantiVAR_013604125R → S1 PublicationCorresponds to variant dbSNP:rs34778053Ensembl.1
Natural variantiVAR_013605253T → M1 PublicationCorresponds to variant dbSNP:rs12468485Ensembl.1
Natural variantiVAR_013606294S → R4 PublicationsCorresponds to variant dbSNP:rs3749172Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0458711M → MLSGSRAVPTPHRGSEELLK YMLHSPCVSLTM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027957 Genomic DNA Translation: AAC52028.1
AF089087 mRNA Translation: AAG17965.1
AY275467 Genomic DNA Translation: AAP32299.1
AK172786 mRNA No translation available.
CR541765 mRNA Translation: CAG46564.1
AC124862 Genomic DNA Translation: AAX88945.1
BC095500 mRNA Translation: AAH95500.1
BC117453 mRNA Translation: AAI17454.2
BC117455 mRNA Translation: AAI17456.2
CCDSiCCDS2541.1 [Q9HC97-1]
CCDS56174.1 [Q9HC97-2]
RefSeqiNP_001182310.1, NM_001195381.1 [Q9HC97-2]
NP_001182311.1, NM_001195382.1 [Q9HC97-2]
NP_005292.2, NM_005301.3 [Q9HC97-1]
UniGeneiHs.112218

Genome annotation databases

EnsembliENST00000319838; ENSP00000322731; ENSG00000178623 [Q9HC97-1]
ENST00000403859; ENSP00000385140; ENSG00000178623 [Q9HC97-1]
ENST00000407714; ENSP00000384263; ENSG00000178623 [Q9HC97-1]
ENST00000430267; ENSP00000411788; ENSG00000178623 [Q9HC97-2]
ENST00000438013; ENSP00000415890; ENSG00000178623 [Q9HC97-1]
GeneIDi2859
KEGGihsa:2859
UCSCiuc002vzs.4 human [Q9HC97-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF027957 Genomic DNA Translation: AAC52028.1
AF089087 mRNA Translation: AAG17965.1
AY275467 Genomic DNA Translation: AAP32299.1
AK172786 mRNA No translation available.
CR541765 mRNA Translation: CAG46564.1
AC124862 Genomic DNA Translation: AAX88945.1
BC095500 mRNA Translation: AAH95500.1
BC117453 mRNA Translation: AAI17454.2
BC117455 mRNA Translation: AAI17456.2
CCDSiCCDS2541.1 [Q9HC97-1]
CCDS56174.1 [Q9HC97-2]
RefSeqiNP_001182310.1, NM_001195381.1 [Q9HC97-2]
NP_001182311.1, NM_001195382.1 [Q9HC97-2]
NP_005292.2, NM_005301.3 [Q9HC97-1]
UniGeneiHs.112218

3D structure databases

ProteinModelPortaliQ9HC97
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109117, 7 interactors
STRINGi9606.ENSP00000415890

Chemistry databases

BindingDBiQ9HC97
ChEMBLiCHEMBL1293267
GuidetoPHARMACOLOGYi102

Protein family/group databases

TCDBi9.A.14.13.8 the g-protein-coupled receptor (gpcr) family
GPCRDBiSearch...

PTM databases

iPTMnetiQ9HC97
PhosphoSitePlusiQ9HC97

Polymorphism and mutation databases

BioMutaiGPR35
DMDMi68068087

Proteomic databases

PaxDbiQ9HC97
PeptideAtlasiQ9HC97
PRIDEiQ9HC97
ProteomicsDBi81658

Protocols and materials databases

DNASUi2859
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000319838; ENSP00000322731; ENSG00000178623 [Q9HC97-1]
ENST00000403859; ENSP00000385140; ENSG00000178623 [Q9HC97-1]
ENST00000407714; ENSP00000384263; ENSG00000178623 [Q9HC97-1]
ENST00000430267; ENSP00000411788; ENSG00000178623 [Q9HC97-2]
ENST00000438013; ENSP00000415890; ENSG00000178623 [Q9HC97-1]
GeneIDi2859
KEGGihsa:2859
UCSCiuc002vzs.4 human [Q9HC97-1]

Organism-specific databases

CTDi2859
DisGeNETi2859
EuPathDBiHostDB:ENSG00000178623.11
GeneCardsiGPR35
H-InvDBiHIX0077670
HGNCiHGNC:4492 GPR35
MalaCardsiGPR35
MIMi602646 gene
neXtProtiNX_Q9HC97
OpenTargetsiENSG00000178623
Orphaneti171 Primary sclerosing cholangitis
PharmGKBiPA28880
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IE2J Eukaryota
ENOG4111JSA LUCA
GeneTreeiENSGT00920000149026
HOVERGENiHBG101122
InParanoidiQ9HC97
KOiK04276
OMAiDANCCLD
OrthoDBiEOG091G0JBB
PhylomeDBiQ9HC97
TreeFamiTF335578

Enzyme and pathway databases

ReactomeiR-HSA-373076 Class A/1 (Rhodopsin-like receptors)

Miscellaneous databases

GenomeRNAii2859
PROiPR:Q9HC97
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000178623 Expressed in 105 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_GPR35
GenevisibleiQ9HC97 HS

Family and domain databases

InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGPR35_HUMAN
AccessioniPrimary (citable) accession number: Q9HC97
Secondary accession number(s): J3KR30
, O43495, Q17R58, Q4VBN5, Q4ZFV2, Q6FHI8, Q86UH4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 14, 2001
Last sequence update: June 21, 2005
Last modified: November 7, 2018
This is version 139 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again