Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sentrin-specific protease 2

Gene

SENP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Protease that catalyzes two essential functions in the SUMO pathway. The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, SUMO1, SUMO2 and SUMO3 leading to the mature form of the proteins. The second is the deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins, by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein. May down-regulate CTNNB1 levels and thereby modulate the Wnt pathway. Deconjugates SUMO2 from MTA1. Plays a dynamic role in adipogenesis by desumoylating and promoting the stabilization of CEBPB (PubMed:20194620).By similarity4 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei4781
Active sitei4951
Active sitei548Nucleophile1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processmRNA transport, Protein transport, Translocation, Transport, Ubl conjugation pathway, Wnt signaling pathway

Enzyme and pathway databases

BRENDAi3.4.22.B71 2681
ReactomeiR-HSA-3065679 SUMO is proteolytically processed

Protein family/group databases

MEROPSiC48.007
TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Sentrin-specific protease 2 (EC:3.4.22.-)
Alternative name(s):
Axam2
SMT3-specific isopeptidase 2
Short name:
Smt3ip2
Sentrin/SUMO-specific protease SENP2
Gene namesi
Name:SENP2
Synonyms:KIAA1331
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000163904.12
HGNCiHGNC:23116 SENP2
MIMi608261 gene
neXtProtiNX_Q9HC62

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi548C → S: Does not desumoylate CEBPB. 1 Publication1
Mutagenesisi576 – 577RK → LM: Does not desumoylate CEBPB. 1 Publication2

Organism-specific databases

DisGeNETi59343
OpenTargetsiENSG00000163904
PharmGKBiPA134955185

Chemistry databases

ChEMBLiCHEMBL2176776

Polymorphism and mutation databases

BioMutaiSENP2
DMDMi143811458

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001017181 – 589Sentrin-specific protease 2Add BLAST589

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei32PhosphoserineCombined sources1
Modified residuei333PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1

Post-translational modificationi

Polyubiquitinated; which leads to proteasomal degradation.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9HC62
MaxQBiQ9HC62
PaxDbiQ9HC62
PeptideAtlasiQ9HC62
PRIDEiQ9HC62
ProteomicsDBi81643

PTM databases

iPTMnetiQ9HC62
PhosphoSitePlusiQ9HC62

Expressioni

Gene expression databases

BgeeiENSG00000163904
CleanExiHS_SENP2
ExpressionAtlasiQ9HC62 baseline and differential
GenevisibleiQ9HC62 HS

Organism-specific databases

HPAiHPA029247
HPA029248

Interactioni

Subunit structurei

Binds to SUMO2 and SUMO3 (By similarity). Interacts with the C-terminal domain of NUP153 via its N-terminus. Interacts with MTA1.By similarity4 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121885, 42 interactors
DIPiDIP-29254N
IntActiQ9HC62, 35 interactors
MINTiQ9HC62
STRINGi9606.ENSP00000296257

Chemistry databases

BindingDBiQ9HC62

Structurei

Secondary structure

1589
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni213 – 215Combined sources3
Beta strandi216 – 220Combined sources5
Helixi231 – 246Combined sources16
Beta strandi259 – 262Combined sources4
Helixi370 – 380Combined sources11
Beta strandi381 – 383Combined sources3
Beta strandi388 – 392Combined sources5
Beta strandi396 – 398Combined sources3
Helixi399 – 402Combined sources4
Helixi403 – 405Combined sources3
Helixi413 – 430Combined sources18
Beta strandi435 – 437Combined sources3
Helixi442 – 454Combined sources13
Helixi455 – 458Combined sources4
Helixi463 – 465Combined sources3
Beta strandi466 – 474Combined sources9
Beta strandi479 – 485Combined sources7
Turni486 – 489Combined sources4
Beta strandi490 – 494Combined sources5
Beta strandi496 – 498Combined sources3
Helixi502 – 519Combined sources18
Helixi526 – 528Combined sources3
Beta strandi530 – 533Combined sources4
Turni536 – 538Combined sources3
Turni543 – 546Combined sources4
Helixi548 – 560Combined sources13
Helixi569 – 571Combined sources3
Helixi572 – 585Combined sources14

3D structure databases

ProteinModelPortaliQ9HC62
SMRiQ9HC62
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HC62

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni396 – 560ProteaseAdd BLAST165

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi28 – 31Nuclear localization signal1 Publication4
Motifi46 – 51Nuclear localization signal1 Publication6
Motifi317 – 332Nuclear export signalAdd BLAST16

Domaini

The N-terminus is necessary and sufficient for nuclear envelope targeting.

Sequence similaritiesi

Belongs to the peptidase C48 family.Curated

Phylogenomic databases

eggNOGiKOG0778 Eukaryota
COG5160 LUCA
GeneTreeiENSGT00530000062941
HOGENOMiHOG000070234
HOVERGENiHBG054228
InParanoidiQ9HC62
KOiK03345
OMAiRRGYQLE
OrthoDBiEOG091G092N
PhylomeDBiQ9HC62
TreeFamiTF316289

Family and domain databases

InterProiView protein in InterPro
IPR038765 Papain_like_cys_pep_sf
IPR003653 Peptidase_C48_C
PfamiView protein in Pfam
PF02902 Peptidase_C48, 1 hit
SUPFAMiSSF54001 SSF54001, 1 hit
PROSITEiView protein in PROSITE
PS50600 ULP_PROTEASE, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9HC62-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYRWLVRILG TIFRFCDRSV PPARALLKRR RSDSTLFSTV DTDEIPAKRP
60 70 80 90 100
RLDCFIHQVK NSLYNAASLF GFPFQLTTKP MVTSACNGTR NVAPSGEVFS
110 120 130 140 150
NSSSCELTGS GSWNNMLKLG NKSPNGISDY PKIRVTVTRD QPRRVLPSFG
160 170 180 190 200
FTLNSEGCNR RPGGRRHSKG NPESSLMWKP QEQAVTEMIS EESGKGLRRP
210 220 230 240 250
HCTVEEGVQK EEREKYRKLL ERLKESGHGN SVCPVTSNYH SSQRSQMDTL
260 270 280 290 300
KTKGWGEEQN HGVKTTQFVP KQYRLVETRG PLCSLRSEKR CSKGKITDTE
310 320 330 340 350
TMVGIRFENE SRRGYQLEPD LSEEVSARLR LGSGSNGLLR RKVSIIETKE
360 370 380 390 400
KNCSGKERDR RTDDLLELTE DMEKEISNAL GHGPQDEILS SAFKLRITRG
410 420 430 440 450
DIQTLKNYHW LNDEVINFYM NLLVERNKKQ GYPALHVFST FFYPKLKSGG
460 470 480 490 500
YQAVKRWTKG VNLFEQEIIL VPIHRKVHWS LVVIDLRKKC LKYLDSMGQK
510 520 530 540 550
GHRICEILLQ YLQDESKTKR NSDLNLLEWT HHSMKPHEIP QQLNGSDCGM
560 570 580
FTCKYADYIS RDKPITFTQH QMPLFRKKMV WEILHQQLL
Length:589
Mass (Da):67,855
Last modified:April 3, 2007 - v3
Checksum:i712707DCC2C5431C
GO
Isoform 2 (identifier: Q9HC62-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MYRWLVRILGTIFRFCDRSVPPARALLKRRRSD → MDSHPCLYCGPQDSEGTNWQTSP

Note: No experimental confirmation available.
Show »
Length:579
Mass (Da):66,358
Checksum:i06C0D0649B5BCFC7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti39T → TA in AAG15309 (Ref. 1) Curated1
Sequence conflicti403Q → H in BAB55222 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029650301T → K4 PublicationsCorresponds to variant dbSNP:rs6762208Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0566971 – 33MYRWL…RRRSD → MDSHPCLYCGPQDSEGTNWQ TSP in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF151697 mRNA Translation: AAG15309.2
AB037752 mRNA Translation: BAA92569.2
AK027599 mRNA Translation: BAB55222.1
AK298628 mRNA Translation: BAG60804.1
AC016961 Genomic DNA No translation available.
AC133473 Genomic DNA No translation available.
BC040609 mRNA Translation: AAH40609.1
AL834380 mRNA Translation: CAD39043.1
CCDSiCCDS33902.1 [Q9HC62-1]
RefSeqiNP_067640.2, NM_021627.2 [Q9HC62-1]
UniGeneiHs.401388

Genome annotation databases

EnsembliENST00000296257; ENSP00000296257; ENSG00000163904 [Q9HC62-1]
GeneIDi59343
KEGGihsa:59343
UCSCiuc003fpn.4 human [Q9HC62-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSENP2_HUMAN
AccessioniPrimary (citable) accession number: Q9HC62
Secondary accession number(s): B4DQ42
, Q8IW97, Q96SR2, Q9P2L5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2002
Last sequence update: April 3, 2007
Last modified: July 18, 2018
This is version 165 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health