Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protein 165

Gene

TMEM165

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a calcium/proton transporter involved in calcium and in lysosomal pH homeostasis. Therefore, it may play an indirect role in protein glycosylation.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • cellular calcium ion homeostasis Source: UniProtKB
  • Golgi calcium ion transport Source: UniProtKB
  • protein N-linked glycosylation Source: UniProtKB
  • regulation of lysosomal lumen pH Source: UniProtKB

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.106.2.2 the ca(2+):h(+) antiporter-2 (caca2) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein 165
Alternative name(s):
Transmembrane protein PT27
Transmembrane protein TPARL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMEM165
Synonyms:TPARL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000134851.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30760 TMEM165

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614726 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HC07

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini34 – 89LumenalSequence analysisAdd BLAST56
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei90 – 110HelicalSequence analysisAdd BLAST21
Topological domaini111 – 126CytoplasmicSequence analysisAdd BLAST16
Transmembranei127 – 147HelicalSequence analysisAdd BLAST21
Topological domaini148 – 151LumenalSequence analysis4
Transmembranei152 – 172HelicalSequence analysisAdd BLAST21
Topological domaini173 – 228CytoplasmicSequence analysisAdd BLAST56
Transmembranei229 – 249HelicalSequence analysisAdd BLAST21
Topological domaini250 – 267LumenalSequence analysisAdd BLAST18
Transmembranei268 – 288HelicalSequence analysisAdd BLAST21
Topological domaini289 – 299CytoplasmicSequence analysisAdd BLAST11
Transmembranei300 – 320HelicalSequence analysisAdd BLAST21
Topological domaini321 – 324LumenalSequence analysis4

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Endosome, Golgi apparatus, Lysosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Congenital disorder of glycosylation 2K (CDG2K)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder with a variable phenotype. Affected individuals show psychomotor retardation and growth retardation, and most have short stature. Other features include dysmorphism, hypotonia, eye abnormalities, acquired microcephaly, hepatomegaly, and skeletal dysplasia. Congenital disorders of glycosylation are caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins and a wide variety of clinical features. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions.
See also OMIM:614727
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_068446126R → C in CDG2K; alters subcellular location. 2 PublicationsCorresponds to variant dbSNP:rs387907222EnsemblClinVar.1
Natural variantiVAR_068447126R → H in CDG2K; alters subcellular location. 2 PublicationsCorresponds to variant dbSNP:rs387907221EnsemblClinVar.1
Natural variantiVAR_068448304G → R in CDG2K; accumulates in Golgi compartment. 2 PublicationsCorresponds to variant dbSNP:rs886037631EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi124Y → S: Alters subcellular location. 1 Publication1
Mutagenesisi127L → G: No effect on subcellular location. 1 Publication1
Mutagenesisi209 – 210LL → GG: No effect on subcellular location. 1 Publication2

Keywords - Diseasei

Congenital disorder of glycosylation, Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
55858

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
TMEM165

MalaCards human disease database

More...
MalaCardsi
TMEM165
MIMi614727 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000134851

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
314667 TMEM165-CDG

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA147357214

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74718825

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 33Sequence analysisAdd BLAST33
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024733434 – 324Transmembrane protein 165Add BLAST291

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HC07

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HC07

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HC07

PeptideAtlas

More...
PeptideAtlasi
Q9HC07

PRoteomics IDEntifications database

More...
PRIDEi
Q9HC07

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81617

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HC07

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HC07

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9HC07

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000134851 Expressed in 218 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_TMEM165

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HC07 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HC07 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038299
HPA062424

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120960, 33 interactors

Protein interaction database and analysis system

More...
IntActi
Q9HC07, 31 interactors

Molecular INTeraction database

More...
MINTi
Q9HC07

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000370736

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9HC07

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili184 – 211Sequence analysisAdd BLAST28

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GDT1 family.Curated

Keywords - Domaini

Coiled coil, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2881 Eukaryota
COG2119 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005261

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000224541

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG002358

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HC07

Identification of Orthologs from Complete Genome Data

More...
OMAi
PIFVQAF

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0LRI

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HC07

TreeFam database of animal gene trees

More...
TreeFami
TF105960

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001727 Gdt1

The PANTHER Classification System

More...
PANTHERi
PTHR12608 PTHR12608, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01169 UPF0016, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01214 UPF0016, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HC07-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAAPGNGR ASAPRLLLLF LVPLLWAPAA VRAGPDEDLS HRNKEPPAPA
60 70 80 90 100
QQLQPQPVAV QGPEPARVEK IFTPAAPVHT NKEDPATQTN LGFIHAFVAA
110 120 130 140 150
ISVIIVSELG DKTFFIAAIM AMRYNRLTVL AGAMLALGLM TCLSVLFGYA
160 170 180 190 200
TTVIPRVYTY YVSTVLFAIF GIRMLREGLK MSPDEGQEEL EEVQAELKKK
210 220 230 240 250
DEEFQRTKLL NGPGDVETGT SITVPQKKWL HFISPIFVQA LTLTFLAEWG
260 270 280 290 300
DRSQLTTIVL AAREDPYGVA VGGTVGHCLC TGLAVIGGRM IAQKISVRTV
310 320
TIIGGIVFLA FAFSALFISP DSGF
Length:324
Mass (Da):34,906
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA0E6C8BBFF189D72
GO
Isoform 2 (identifier: Q9HC07-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVE → MEIPMQ

Note: No experimental confirmation available.
Show »
Length:261
Mass (Da):28,432
Checksum:i16F4AA6268D395EF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GY93V9GY93_HUMAN
Transmembrane protein 165
TMEM165
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RD79D6RD79_HUMAN
Transmembrane protein 165
TMEM165
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBL0D6RBL0_HUMAN
Transmembrane protein 165
TMEM165
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GYC8V9GYC8_HUMAN
Transmembrane protein 165
TMEM165
27Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF67653 differs from that shown. Reason: Frameshift at positions 2 and 7.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_068446126R → C in CDG2K; alters subcellular location. 2 PublicationsCorresponds to variant dbSNP:rs387907222EnsemblClinVar.1
Natural variantiVAR_068447126R → H in CDG2K; alters subcellular location. 2 PublicationsCorresponds to variant dbSNP:rs387907221EnsemblClinVar.1
Natural variantiVAR_068448304G → R in CDG2K; accumulates in Golgi compartment. 2 PublicationsCorresponds to variant dbSNP:rs886037631EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566911 – 69MAAAA…PARVE → MEIPMQ in isoform 2. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF132746 mRNA Translation: AAL75947.1
AF183409 mRNA Translation: AAG09678.1
AF220188 mRNA Translation: AAF67653.1 Frameshift.
AK290663 mRNA Translation: BAF83352.1
AK295289 mRNA Translation: BAG58273.1
AC069200 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05467.1
BC003545 mRNA Translation: AAH03545.2
BC104980 mRNA Translation: AAI04981.1
BC104978 mRNA Translation: AAI04979.1
BC107582 mRNA Translation: AAI07583.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3499.1 [Q9HC07-1]

NCBI Reference Sequences

More...
RefSeqi
NP_060945.2, NM_018475.4 [Q9HC07-1]
XP_016863901.1, XM_017008412.1 [Q9HC07-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.479766

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000381334; ENSP00000370736; ENSG00000134851 [Q9HC07-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55858

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55858

UCSC genome browser

More...
UCSCi
uc003hax.4 human [Q9HC07-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132746 mRNA Translation: AAL75947.1
AF183409 mRNA Translation: AAG09678.1
AF220188 mRNA Translation: AAF67653.1 Frameshift.
AK290663 mRNA Translation: BAF83352.1
AK295289 mRNA Translation: BAG58273.1
AC069200 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX05467.1
BC003545 mRNA Translation: AAH03545.2
BC104980 mRNA Translation: AAI04981.1
BC104978 mRNA Translation: AAI04979.1
BC107582 mRNA Translation: AAI07583.1
CCDSiCCDS3499.1 [Q9HC07-1]
RefSeqiNP_060945.2, NM_018475.4 [Q9HC07-1]
XP_016863901.1, XM_017008412.1 [Q9HC07-2]
UniGeneiHs.479766

3D structure databases

ProteinModelPortaliQ9HC07
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120960, 33 interactors
IntActiQ9HC07, 31 interactors
MINTiQ9HC07
STRINGi9606.ENSP00000370736

Protein family/group databases

TCDBi2.A.106.2.2 the ca(2+):h(+) antiporter-2 (caca2) family

PTM databases

iPTMnetiQ9HC07
PhosphoSitePlusiQ9HC07
SwissPalmiQ9HC07

Polymorphism and mutation databases

DMDMi74718825

Proteomic databases

EPDiQ9HC07
MaxQBiQ9HC07
PaxDbiQ9HC07
PeptideAtlasiQ9HC07
PRIDEiQ9HC07
ProteomicsDBi81617

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000381334; ENSP00000370736; ENSG00000134851 [Q9HC07-1]
GeneIDi55858
KEGGihsa:55858
UCSCiuc003hax.4 human [Q9HC07-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55858
DisGeNETi55858
EuPathDBiHostDB:ENSG00000134851.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMEM165
GeneReviewsiTMEM165

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0004223
HGNCiHGNC:30760 TMEM165
HPAiHPA038299
HPA062424
MalaCardsiTMEM165
MIMi614726 gene
614727 phenotype
neXtProtiNX_Q9HC07
OpenTargetsiENSG00000134851
Orphaneti314667 TMEM165-CDG
PharmGKBiPA147357214

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2881 Eukaryota
COG2119 LUCA
GeneTreeiENSGT00390000005261
HOGENOMiHOG000224541
HOVERGENiHBG002358
InParanoidiQ9HC07
OMAiPIFVQAF
OrthoDBiEOG091G0LRI
PhylomeDBiQ9HC07
TreeFamiTF105960

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMEM165 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55858

Protein Ontology

More...
PROi
PR:Q9HC07

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000134851 Expressed in 218 organ(s), highest expression level in corpus callosum
CleanExiHS_TMEM165
ExpressionAtlasiQ9HC07 baseline and differential
GenevisibleiQ9HC07 HS

Family and domain databases

InterProiView protein in InterPro
IPR001727 Gdt1
PANTHERiPTHR12608 PTHR12608, 1 hit
PfamiView protein in Pfam
PF01169 UPF0016, 2 hits
PROSITEiView protein in PROSITE
PS01214 UPF0016, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM165_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HC07
Secondary accession number(s): A8K3P8
, B4DHW1, Q9BTN9, Q9NZ34
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 1, 2001
Last modified: December 5, 2018
This is version 124 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again