Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (08 May 2019)
Sequence version 2 (04 Dec 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Relaxin receptor 1

Gene

RXFP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi45Calcium; via carbonyl oxygen1
Metal bindingi48Calcium1
Metal bindingi50Calcium; via carbonyl oxygen1
Metal bindingi52Calcium1
Metal bindingi58Calcium1
Metal bindingi59Calcium1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418555 G alpha (s) signalling events
R-HSA-444821 Relaxin receptors

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9HBX9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Relaxin receptor 1
Alternative name(s):
Leucine-rich repeat-containing G-protein coupled receptor 7
Relaxin family peptide receptor 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RXFP1
Synonyms:LGR7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19718 RXFP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606654 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HBX9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 409ExtracellularSequence analysisAdd BLAST409
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei410 – 430Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini431 – 443CytoplasmicSequence analysisAdd BLAST13
Transmembranei444 – 464Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini465 – 486ExtracellularSequence analysisAdd BLAST22
Transmembranei487 – 507Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini508 – 527CytoplasmicSequence analysisAdd BLAST20
Transmembranei528 – 548Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini549 – 577ExtracellularSequence analysisAdd BLAST29
Transmembranei578 – 598Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini599 – 629CytoplasmicSequence analysisAdd BLAST31
Transmembranei630 – 650Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini651ExtracellularSequence analysis1
Transmembranei652 – 672Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini673 – 757CytoplasmicSequence analysisAdd BLAST85

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi637D → Y: Leads to constitutive increase of basal cAMP. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
59350

Open Targets

More...
OpenTargetsi
ENSG00000171509

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134868312

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1293316

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
351

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RXFP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166209887

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000697001 – 757Relaxin receptor 1Add BLAST757

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi27 ↔ 40
Disulfide bondi34 ↔ 53
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi36N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi47 ↔ 62
Glycosylationi127N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi264N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi272N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi325N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi368N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi485 ↔ 563

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HBX9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HBX9

PeptideAtlas

More...
PeptideAtlasi
Q9HBX9

PRoteomics IDEntifications database

More...
PRIDEi
Q9HBX9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81607
81608 [Q9HBX9-2]
81609 [Q9HBX9-3]
81610 [Q9HBX9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HBX9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HBX9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171509 Expressed in 94 organ(s), highest expression level in decidua

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HBX9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HBX9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA027067

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with C1QTNF8.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
AKAP5P245882EBI-8088969,EBI-703640

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121891, 86 interactors

Protein interaction database and analysis system

More...
IntActi
Q9HBX9, 5 interactors

Molecular INTeraction database

More...
MINTi
Q9HBX9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000405841

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q9HBX9

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1757
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JM4NMR-A23-63[»]
2M7PNMR-A28-39[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HBX9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9HBX9

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini26 – 63LDL-receptor class APROSITE-ProRule annotationAdd BLAST38
Domaini91 – 127LRRNTAdd BLAST37
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati151 – 172LRR 1Add BLAST22
Repeati175 – 196LRR 2Add BLAST22
Repeati199 – 220LRR 3Add BLAST22
Repeati223 – 244LRR 4Add BLAST22
Repeati248 – 269LRR 5Add BLAST22
Repeati272 – 293LRR 6Add BLAST22
Repeati296 – 317LRR 7Add BLAST22
Repeati320 – 341LRR 8Add BLAST22
Repeati344 – 365LRR 9Add BLAST22

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0619 Eukaryota
KOG2087 Eukaryota
COG4886 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158241

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000049056

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HBX9

KEGG Orthology (KO)

More...
KOi
K04306

Database of Orthologous Groups

More...
OrthoDBi
953529at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HBX9

TreeFam database of animal gene trees

More...
TreeFami
TF326185

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00112 LDLa, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.80.10.10, 2 hits
4.10.400.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR036055 LDL_receptor-like_sf
IPR023415 LDLR_class-A_CS
IPR002172 LDrepeatLR_classA_rpt
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR008112 Relaxin_rcpt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00001 7tm_1, 1 hit
PF00057 Ldl_recept_a, 1 hit
PF13855 LRR_8, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00237 GPCRRHODOPSN
PR01739 RELAXINR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00192 LDLa, 1 hit
SM00369 LRR_TYP, 9 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57424 SSF57424, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
PS01209 LDLRA_1, 1 hit
PS50068 LDLRA_2, 1 hit
PS51450 LRR, 10 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HBX9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSGSVFFYI LIFGKYFSHG GGQDVKCSLG YFPCGNITKC LPQLLHCNGV
60 70 80 90 100
DDCGNQADED NCGDNNGWSL QFDKYFASYY KMTSQYPFEA ETPECLVGSV
110 120 130 140 150
PVQCLCQGLE LDCDETNLRA VPSVSSNVTA MSLQWNLIRK LPPDCFKNYH
160 170 180 190 200
DLQKLYLQNN KITSISIYAF RGLNSLTKLY LSHNRITFLK PGVFEDLHRL
210 220 230 240 250
EWLIIEDNHL SRISPPTFYG LNSLILLVLM NNVLTRLPDK PLCQHMPRLH
260 270 280 290 300
WLDLEGNHIH NLRNLTFISC SNLTVLVMRK NKINHLNENT FAPLQKLDEL
310 320 330 340 350
DLGSNKIENL PPLIFKDLKE LSQLNLSYNP IQKIQANQFD YLVKLKSLSL
360 370 380 390 400
EGIEISNIQQ RMFRPLMNLS HIYFKKFQYC GYAPHVRSCK PNTDGISSLE
410 420 430 440 450
NLLASIIQRV FVWVVSAVTC FGNIFVICMR PYIRSENKLY AMSIISLCCA
460 470 480 490 500
DCLMGIYLFV IGGFDLKFRG EYNKHAQLWM ESTHCQLVGS LAILSTEVSV
510 520 530 540 550
LLLTFLTLEK YICIVYPFRC VRPGKCRTIT VLILIWITGF IVAFIPLSNK
560 570 580 590 600
EFFKNYYGTN GVCFPLHSED TESIGAQIYS VAIFLGINLA AFIIIVFSYG
610 620 630 640 650
SMFYSVHQSA ITATEIRNQV KKEMILAKRF FFIVFTDALC WIPIFVVKFL
660 670 680 690 700
SLLQVEIPGT ITSWVVIFIL PINSALNPIL YTLTTRPFKE MIHRFWYNYR
710 720 730 740 750
QRKSMDSKGQ KTYAPSFIWV EMWPLQEMPP ELMKPDLFTY PCEMSLISQS

TRLNSYS
Length:757
Mass (Da):86,975
Last modified:December 4, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB32DD71B1A5D5864
GO
Isoform 2 (identifier: Q9HBX9-2) [UniParc]FASTAAdd to basket
Also known as: LGR7.10

The sequence of this isoform differs from the canonical sequence as follows:
     63-96: GDNNGWSLQFDKYFASYYKMTSQYPFEAETPECL → V

Show »
Length:724
Mass (Da):83,060
Checksum:i10976FE385EFEAF8
GO
Isoform 3 (identifier: Q9HBX9-3) [UniParc]FASTAAdd to basket
Also known as: LGR7.1

The sequence of this isoform differs from the canonical sequence as follows:
     180-189: YLSHNRITFL → SRAVKDGSEK
     190-757: Missing.

Show »
Length:189
Mass (Da):21,112
Checksum:iB9B3EF4D3C62778F
GO
Isoform 4 (identifier: Q9HBX9-4) [UniParc]FASTAAdd to basket
Also known as: LGR7.2

The sequence of this isoform differs from the canonical sequence as follows:
     300-348: LDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSL → F

Show »
Length:709
Mass (Da):81,481
Checksum:i18F5684D7CF67595
GO
Isoform 5 (identifier: Q9HBX9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     252-275: Missing.

Note: No experimental confirmation available.
Show »
Length:652
Mass (Da):75,272
Checksum:i8E942E974CFBF545
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DGP2B4DGP2_HUMAN
cDNA FLJ53318, highly similar to Re...
RXFP1
784Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIF0E9PIF0_HUMAN
Relaxin receptor 1
RXFP1
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PCA3E9PCA3_HUMAN
Relaxin receptor 1
RXFP1
676Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT52A0A0A0MT52_HUMAN
Relaxin receptor 1
RXFP1
601Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWV0A0A087WWV0_HUMAN
Relaxin receptor 1
RXFP1
626Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti70L → M in AAG17167 (PubMed:10935549).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0543751 – 81Missing in isoform 5. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_00198463 – 96GDNNG…TPECL → V in isoform 2. 3 PublicationsAdd BLAST34
Alternative sequenceiVSP_029877180 – 189YLSHNRITFL → SRAVKDGSEK in isoform 3. 1 Publication10
Alternative sequenceiVSP_029878190 – 757Missing in isoform 3. 1 PublicationAdd BLAST568
Alternative sequenceiVSP_054376252 – 275Missing in isoform 5. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_029879300 – 348LDLGS…KLKSL → F in isoform 4. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF190500 mRNA Translation: AAG17167.1
AY899848 mRNA Translation: AAX85196.1
AY899849 mRNA Translation: AAX85197.1
AY899850 mRNA Translation: AAX85198.1
AK295040 mRNA Translation: BAG58092.1
AK300379 mRNA Translation: BAG62114.1
AC019341 Genomic DNA No translation available.
AC107056 Genomic DNA No translation available.
AC107219 Genomic DNA No translation available.
AC108017 Genomic DNA No translation available.
AC121161 Genomic DNA No translation available.
AC125489 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04856.1
BC112142 mRNA Translation: AAI12143.1
BC113617 mRNA Translation: AAI13618.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43276.1 [Q9HBX9-1]
CCDS58929.1 [Q9HBX9-4]
CCDS58930.1 [Q9HBX9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001240657.1, NM_001253728.1 [Q9HBX9-2]
NP_001240658.1, NM_001253729.1 [Q9HBX9-4]
NP_067647.2, NM_021634.3 [Q9HBX9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000307765; ENSP00000303248; ENSG00000171509 [Q9HBX9-1]
ENST00000343542; ENSP00000345889; ENSG00000171509 [Q9HBX9-4]
ENST00000470033; ENSP00000420712; ENSG00000171509 [Q9HBX9-2]
ENST00000471616; ENSP00000434475; ENSG00000171509 [Q9HBX9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
59350

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:59350

UCSC genome browser

More...
UCSCi
uc003ipz.4 human [Q9HBX9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190500 mRNA Translation: AAG17167.1
AY899848 mRNA Translation: AAX85196.1
AY899849 mRNA Translation: AAX85197.1
AY899850 mRNA Translation: AAX85198.1
AK295040 mRNA Translation: BAG58092.1
AK300379 mRNA Translation: BAG62114.1
AC019341 Genomic DNA No translation available.
AC107056 Genomic DNA No translation available.
AC107219 Genomic DNA No translation available.
AC108017 Genomic DNA No translation available.
AC121161 Genomic DNA No translation available.
AC125489 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04856.1
BC112142 mRNA Translation: AAI12143.1
BC113617 mRNA Translation: AAI13618.1
CCDSiCCDS43276.1 [Q9HBX9-1]
CCDS58929.1 [Q9HBX9-4]
CCDS58930.1 [Q9HBX9-2]
RefSeqiNP_001240657.1, NM_001253728.1 [Q9HBX9-2]
NP_001240658.1, NM_001253729.1 [Q9HBX9-4]
NP_067647.2, NM_021634.3 [Q9HBX9-1]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2JM4NMR-A23-63[»]
2M7PNMR-A28-39[»]
SMRiQ9HBX9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121891, 86 interactors
IntActiQ9HBX9, 5 interactors
MINTiQ9HBX9
STRINGi9606.ENSP00000405841

Chemistry databases

BindingDBiQ9HBX9
ChEMBLiCHEMBL1293316
GuidetoPHARMACOLOGYi351

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

iPTMnetiQ9HBX9
PhosphoSitePlusiQ9HBX9

Polymorphism and mutation databases

BioMutaiRXFP1
DMDMi166209887

Proteomic databases

MaxQBiQ9HBX9
PaxDbiQ9HBX9
PeptideAtlasiQ9HBX9
PRIDEiQ9HBX9
ProteomicsDBi81607
81608 [Q9HBX9-2]
81609 [Q9HBX9-3]
81610 [Q9HBX9-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
59350
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307765; ENSP00000303248; ENSG00000171509 [Q9HBX9-1]
ENST00000343542; ENSP00000345889; ENSG00000171509 [Q9HBX9-4]
ENST00000470033; ENSP00000420712; ENSG00000171509 [Q9HBX9-2]
ENST00000471616; ENSP00000434475; ENSG00000171509 [Q9HBX9-3]
GeneIDi59350
KEGGihsa:59350
UCSCiuc003ipz.4 human [Q9HBX9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
59350
DisGeNETi59350

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RXFP1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0024561
HGNCiHGNC:19718 RXFP1
HPAiHPA027067
MIMi606654 gene
neXtProtiNX_Q9HBX9
OpenTargetsiENSG00000171509
PharmGKBiPA134868312

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0619 Eukaryota
KOG2087 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00940000158241
HOGENOMiHOG000049056
InParanoidiQ9HBX9
KOiK04306
OrthoDBi953529at2759
PhylomeDBiQ9HBX9
TreeFamiTF326185

Enzyme and pathway databases

ReactomeiR-HSA-418555 G alpha (s) signalling events
R-HSA-444821 Relaxin receptors
SIGNORiQ9HBX9

Miscellaneous databases

EvolutionaryTraceiQ9HBX9

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Relaxin/insulin-like_family_peptide_receptor_1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
59350

Protein Ontology

More...
PROi
PR:Q9HBX9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171509 Expressed in 94 organ(s), highest expression level in decidua
ExpressionAtlasiQ9HBX9 baseline and differential
GenevisibleiQ9HBX9 HS

Family and domain databases

CDDicd00112 LDLa, 1 hit
Gene3Di3.80.10.10, 2 hits
4.10.400.10, 1 hit
InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR036055 LDL_receptor-like_sf
IPR023415 LDLR_class-A_CS
IPR002172 LDrepeatLR_classA_rpt
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR008112 Relaxin_rcpt
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PF00057 Ldl_recept_a, 1 hit
PF13855 LRR_8, 2 hits
PRINTSiPR00237 GPCRRHODOPSN
PR01739 RELAXINR
SMARTiView protein in SMART
SM00192 LDLa, 1 hit
SM00369 LRR_TYP, 9 hits
SUPFAMiSSF57424 SSF57424, 1 hit
PROSITEiView protein in PROSITE
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit
PS01209 LDLRA_1, 1 hit
PS50068 LDLRA_2, 1 hit
PS51450 LRR, 10 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRXFP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HBX9
Secondary accession number(s): B4DHD1
, B4DTV2, Q2M215, Q3KU24, Q3KU25, Q3KU26
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 6, 2002
Last sequence update: December 4, 2007
Last modified: May 8, 2019
This is version 169 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again