Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tensin-1

Gene

TNS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in fibrillar adhesion formation. May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9HBL0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tensin-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNS1
Synonyms:TNS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000079308.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11973 TNS1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600076 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HBL0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7145

Open Targets

More...
OpenTargetsi
ENSG00000079308

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36660

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TNS1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
212276466

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002159001 – 1735Tensin-1Add BLAST1735

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei338PhosphoserineCombined sources1
Modified residuei364PhosphoserineCombined sources1
Modified residuei366PhosphotyrosineCombined sources1
Modified residuei378PhosphoserineCombined sources1
Modified residuei379PhosphothreonineCombined sources1
Modified residuei433PhosphoserineCombined sources1
Modified residuei621PhosphoserineCombined sources1
Modified residuei701PhosphoserineCombined sources1
Modified residuei764PhosphoserineCombined sources1
Modified residuei769PhosphoserineCombined sources1
Modified residuei794PhosphoserineCombined sources1
Modified residuei860PhosphothreonineCombined sources1
Modified residuei899PhosphoserineCombined sources1
Modified residuei903PhosphotyrosineCombined sources1
Modified residuei907PhosphoserineCombined sources1
Modified residuei963PhosphoserineCombined sources1
Modified residuei967PhosphoserineCombined sources1
Modified residuei1124PhosphoserineCombined sources1
Modified residuei1177PhosphoserineCombined sources1 Publication1
Modified residuei1189PhosphothreonineCombined sources1
Modified residuei1192PhosphoserineCombined sources1
Modified residuei1266PhosphothreonineCombined sources1
Modified residuei1269PhosphoserineCombined sources1
Modified residuei1294PhosphoserineCombined sources1
Modified residuei1309PhosphoserineCombined sources1
Modified residuei1314PhosphoserineCombined sources1
Modified residuei1381PhosphoserineCombined sources1
Modified residuei1393PhosphoserineCombined sources1
Modified residuei1400PhosphoserineCombined sources1
Modified residuei1446PhosphoserineCombined sources1
Modified residuei1588PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Rapidly cleaved by calpain II.

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HBL0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HBL0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HBL0

PeptideAtlas

More...
PeptideAtlasi
Q9HBL0

PRoteomics IDEntifications database

More...
PRIDEi
Q9HBL0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81568

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q9HBL0

DEPOD human dephosphorylation database

More...
DEPODi
Q9HBL0

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HBL0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HBL0

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q9HBL0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000079308 Expressed in 244 organ(s), highest expression level in blood vessel layer

CleanEx database of gene expression profiles

More...
CleanExi
HS_TNS1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HBL0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HBL0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB018774
HPA036089
HPA036090

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds to actin filaments and interacts with phosphotyrosine-containing proteins. Interacts with STARD8.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112999, 19 interactors

Database of interacting proteins

More...
DIPi
DIP-60948N

Protein interaction database and analysis system

More...
IntActi
Q9HBL0, 12 interactors

Molecular INTeraction database

More...
MINTi
Q9HBL0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000171887

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9HBL0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HBL0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 176Phosphatase tensin-typePROSITE-ProRule annotationAdd BLAST173
Domaini181 – 307C2 tensin-typePROSITE-ProRule annotationAdd BLAST127
Domaini1463 – 1572SH2PROSITE-ProRule annotationAdd BLAST110

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi651 – 667Gln-richAdd BLAST17
Compositional biasi1069 – 1160Ser-richAdd BLAST92

Keywords - Domaini

SH2 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1930 Eukaryota
KOG2283 Eukaryota
COG2453 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155400

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000060090

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG060186

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HBL0

KEGG Orthology (KO)

More...
KOi
K18080

Identification of Orthologs from Complete Genome Data

More...
OMAi
RMSMGDR

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0G8Y

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HBL0

TreeFam database of animal gene trees

More...
TreeFami
TF315996

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01213 PTB_tensin, 1 hit
cd09927 SH2_Tensin_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.30.505.10, 1 hit
3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993 PH-like_dom_sf
IPR029021 Prot-tyrosine_phosphatase-like
IPR013625 PTB
IPR006020 PTB/PI_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR014020 Tensin_C2-dom
IPR035012 Tensin_like_SH2
IPR029023 Tensin_phosphatase
IPR033929 Tensin_PTB
IPR003595 Tyr_Pase_cat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08416 PTB, 1 hit
PF10409 PTEN_C2, 1 hit
PF00017 SH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00462 PTB, 1 hit
SM01326 PTEN_C2, 1 hit
SM00404 PTPc_motif, 1 hit
SM00252 SH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 1 hit
SSF55550 SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51181 PPASE_TENSIN, 1 hit
PS50001 SH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HBL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVSRTMEDS CELDLVYVTE RIIAVSFPST ANEENFRSNL REVAQMLKSK
60 70 80 90 100
HGGNYLLFNL SERRPDITKL HAKVLEFGWP DLHTPALEKI CSICKAMDTW
110 120 130 140 150
LNADPHNVVV LHNKGNRGRI GVVIAAYMHY SNISASADQA LDRFAMKRFY
160 170 180 190 200
EDKIVPIGQP SQRRYVHYFS GLLSGSIKMN NKPLFLHHVI MHGIPNFESK
210 220 230 240 250
GGCRPFLRIY QAMQPVYTSG IYNIPGDSQT SVCITIEPGL LLKGDILLKC
260 270 280 290 300
YHKKFRSPAR DVIFRVQFHT CAIHDLGVVF GKEDLDDAFK DDRFPEYGKV
310 320 330 340 350
EFVFSYGPEK IQGMEHLENG PSVSVDYNTS DPLIRWDSYD NFSGHRDDGM
360 370 380 390 400
EEVVGHTQGP LDGSLYAKVK KKDSLHGSTG AVNATRPTLS ATPNHVEHTL
410 420 430 440 450
SVSSDSGNST ASTKTDKTDE PVPGASSATA ALSPQEKREL DRLLSGFGLE
460 470 480 490 500
REKQGAMYHT QHLRSRPAGG SAVPSSGRHV VPAQVHVNGG ALASERETDI
510 520 530 540 550
LDDELPNQDG HSAGSMGTLS SLDGVTNTSE GGYPEALSPL TNGLDKSYPM
560 570 580 590 600
EPMVNGGGYP YESASRAGPA HAGHTAPMRP SYSAQEGLAG YQREGPHPAW
610 620 630 640 650
PQPVTTSHYA HDPSGMFRSQ SFSEAEPQLP PAPVRGGSSR EAVQRGLNSW
660 670 680 690 700
QQQQQQQQQP RPPPRQQERA HLESLVASRP SPQPLAETPI PSLPEFPRAA
710 720 730 740 750
SQQEIEQSIE TLNMLMLDLE PASAAAPLHK SQSVPGAWPG ASPLSSQPLS
760 770 780 790 800
GSSRQSHPLT QSRSGYIPSG HSLGTPEPAP RASLESVPPG RSYSPYDYQP
810 820 830 840 850
CLAGPNQDFH SKSPASSSLP AFLPTTHSPP GPQQPPASLP GLTAQPLLSP
860 870 880 890 900
KEATSDPSRT PEEEPLNLEG LVAHRVAGVQ AREKQPAEPP APLRRRAASD
910 920 930 940 950
GQYENQSPEA TSPRSPGVRS PVQCVSPELA LTIALNPGGR PKEPHLHSYK
960 970 980 990 1000
EAFEEMEGTS PSSPPPSGVR SPPGLAKTPL SALGLKPHNP ADILLHPTGV
1010 1020 1030 1040 1050
TRRRIQPEED EGKVVVRLSE EPRSYVESVA RTAVAGPRAQ DSEPKSFSAP
1060 1070 1080 1090 1100
ATQAYGHEIP LRNGTLGGSF VSPSPLSTSS PILSADSTSV GSFPSGESSD
1110 1120 1130 1140 1150
QGPRTPTQPL LESGFRSGSL GQPSPSAQRN YQSSSPLPTV GSSYSSPDYS
1160 1170 1180 1190 1200
LQHFSSSPES QARAQFSVAG VHTVPGSPQA RHRTVGTNTP PSPGFGWRAI
1210 1220 1230 1240 1250
NPSMAAPSSP SLSHHQMMGP PGTGFHGSTV SSPQSSAATT PGSPSLCRHP
1260 1270 1280 1290 1300
AGVYQVSGLH NKVATTPGSP SLGRHPGAHQ GNLASGLHSN AIASPGSPSL
1310 1320 1330 1340 1350
GRHLGGSGSV VPGSPCLDRH VAYGGYSTPE DRRPTLSRQS SASGYQAPST
1360 1370 1380 1390 1400
PSFPVSPAYY PGLSSPATSP SPDSAAFRQG SPTPALPEKR RMSVGDRAGS
1410 1420 1430 1440 1450
LPNYATINGK VSSPVASGMS SPSGGSTVSF SHTLPDFSKY SMPDNSPETR
1460 1470 1480 1490 1500
AKVKFVQDTS KYWYKPEISR EQAIALLKDQ EPGAFIIRDS HSFRGAYGLA
1510 1520 1530 1540 1550
MKVSSPPPTI MQQNKKGDMT HELVRHFLIE TGPRGVKLKG CPNEPNFGSL
1560 1570 1580 1590 1600
SALVYQHSII PLALPCKLVI PNRDPTDESK DSSGPANSTA DLLKQGAACN
1610 1620 1630 1640 1650
VLFVNSVDME SLTGPQAISK ATSETLAADP TPAATIVHFK VSAQGITLTD
1660 1670 1680 1690 1700
NQRKLFFRRH YPLNTVTFCD LDPQERKWMK TEGGAPAKLF GFVARKQGST
1710 1720 1730
TDNACHLFAE LDPNQPASAI VNFVSKVMLN AGQKR
Length:1,735
Mass (Da):185,701
Last modified:November 4, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i90C173D5E371EF3E
GO
Isoform 2 (identifier: Q9HBL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVPFQQRKDCVLEGSTRVTPSVQPHLQPIRNM
     352-385: EVVGHTQGPLDGSLYAKVKKKDSLHGSTGAVNAT → DGNKQNTNSQSIGSISGGLEDQYTWPDTHWPSQS
     386-1735: Missing.

Note: No experimental confirmation available.
Show »
Length:416
Mass (Da):47,240
Checksum:i372FC64F2304C63E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ERH1E7ERH1_HUMAN
Tensin-1
TNS1
780Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y4T1A0A2R8Y4T1_HUMAN
Tensin-1
TNS1
1,860Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PGF5E9PGF5_HUMAN
Tensin-1
TNS1
1,714Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PF55E9PF55_HUMAN
Tensin-1
TNS1
1,721Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y4U1H0Y4U1_HUMAN
Tensin-1
TNS1
846Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWW7A0A087WWW7_HUMAN
Tensin-1
TNS1
1,365Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EMG1E7EMG1_HUMAN
Tensin-1
TNS1
487Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3Z4H7C3Z4_HUMAN
Tensin-1
TNS1
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JI43C9JI43_HUMAN
Tensin-1
TNS1
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J8K5C9J8K5_HUMAN
Tensin-1
TNS1
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti179M → I in AAG33700 (PubMed:11023826).Curated1
Sequence conflicti1412S → A in AAG33700 (PubMed:11023826).Curated1
Sequence conflicti1416A → P in AAG33700 (PubMed:11023826).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_047066311I → M. Corresponds to variant dbSNP:rs11680854Ensembl.1
Natural variantiVAR_047067466R → C. Corresponds to variant dbSNP:rs3815849Ensembl.1
Natural variantiVAR_047068528T → I. Corresponds to variant dbSNP:rs3796033Ensembl.1
Natural variantiVAR_0470691004R → W. Corresponds to variant dbSNP:rs3796028Ensembl.1
Natural variantiVAR_0480041093F → L in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0470701197W → R Common polymorphism. Combined sources1 PublicationCorresponds to variant dbSNP:rs2571445Ensembl.1
Natural variantiVAR_0470711604V → I1 PublicationCorresponds to variant dbSNP:rs918949Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0563351M → MVPFQQRKDCVLEGSTRVTP SVQPHLQPIRNM in isoform 2. 1 Publication1
Alternative sequenceiVSP_056336352 – 385EVVGH…AVNAT → DGNKQNTNSQSIGSISGGLE DQYTWPDTHWPSQS in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_056337386 – 1735Missing in isoform 2. 1 PublicationAdd BLAST1350

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF225896 mRNA Translation: AAG33700.1
AC009469 Genomic DNA Translation: AAX88952.1
AC010136 Genomic DNA No translation available.
BC071905 mRNA Translation: AAH71905.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2407.1 [Q9HBL0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001294951.1, NM_001308022.1
NP_072174.3, NM_022648.5 [Q9HBL0-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.471381

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000171887; ENSP00000171887; ENSG00000079308 [Q9HBL0-1]
ENST00000310858; ENSP00000308321; ENSG00000079308 [Q9HBL0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7145

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7145

UCSC genome browser

More...
UCSCi
uc002vgt.3 human [Q9HBL0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF225896 mRNA Translation: AAG33700.1
AC009469 Genomic DNA Translation: AAX88952.1
AC010136 Genomic DNA No translation available.
BC071905 mRNA Translation: AAH71905.1
CCDSiCCDS2407.1 [Q9HBL0-1]
RefSeqiNP_001294951.1, NM_001308022.1
NP_072174.3, NM_022648.5 [Q9HBL0-1]
UniGeneiHs.471381

3D structure databases

ProteinModelPortaliQ9HBL0
SMRiQ9HBL0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112999, 19 interactors
DIPiDIP-60948N
IntActiQ9HBL0, 12 interactors
MINTiQ9HBL0
STRINGi9606.ENSP00000171887

PTM databases

CarbonylDBiQ9HBL0
DEPODiQ9HBL0
iPTMnetiQ9HBL0
PhosphoSitePlusiQ9HBL0

Polymorphism and mutation databases

BioMutaiTNS1
DMDMi212276466

Proteomic databases

EPDiQ9HBL0
MaxQBiQ9HBL0
PaxDbiQ9HBL0
PeptideAtlasiQ9HBL0
PRIDEiQ9HBL0
ProteomicsDBi81568

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000171887; ENSP00000171887; ENSG00000079308 [Q9HBL0-1]
ENST00000310858; ENSP00000308321; ENSG00000079308 [Q9HBL0-2]
GeneIDi7145
KEGGihsa:7145
UCSCiuc002vgt.3 human [Q9HBL0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7145
DisGeNETi7145
EuPathDBiHostDB:ENSG00000079308.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TNS1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0002818
HGNCiHGNC:11973 TNS1
HPAiCAB018774
HPA036089
HPA036090
MIMi600076 gene
neXtProtiNX_Q9HBL0
OpenTargetsiENSG00000079308
PharmGKBiPA36660

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1930 Eukaryota
KOG2283 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00940000155400
HOGENOMiHOG000060090
HOVERGENiHBG060186
InParanoidiQ9HBL0
KOiK18080
OMAiRMSMGDR
OrthoDBiEOG091G0G8Y
PhylomeDBiQ9HBL0
TreeFamiTF315996

Enzyme and pathway databases

SignaLinkiQ9HBL0

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TNS1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TNS1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7145
PMAP-CutDBiQ9HBL0

Protein Ontology

More...
PROi
PR:Q9HBL0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000079308 Expressed in 244 organ(s), highest expression level in blood vessel layer
CleanExiHS_TNS1
ExpressionAtlasiQ9HBL0 baseline and differential
GenevisibleiQ9HBL0 HS

Family and domain databases

CDDicd01213 PTB_tensin, 1 hit
cd09927 SH2_Tensin_like, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR029021 Prot-tyrosine_phosphatase-like
IPR013625 PTB
IPR006020 PTB/PI_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR014020 Tensin_C2-dom
IPR035012 Tensin_like_SH2
IPR029023 Tensin_phosphatase
IPR033929 Tensin_PTB
IPR003595 Tyr_Pase_cat
PfamiView protein in Pfam
PF08416 PTB, 1 hit
PF10409 PTEN_C2, 1 hit
PF00017 SH2, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM01326 PTEN_C2, 1 hit
SM00404 PTPc_motif, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51181 PPASE_TENSIN, 1 hit
PS50001 SH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTENS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HBL0
Secondary accession number(s): Q4ZG71, Q6IPI5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: November 4, 2008
Last modified: December 5, 2018
This is version 158 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again