Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tensin-1

Gene

TNS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in fibrillar adhesion formation. May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Enzyme and pathway databases

SignaLinkiQ9HBL0

Names & Taxonomyi

Protein namesi
Recommended name:
Tensin-1
Gene namesi
Name:TNS1
Synonyms:TNS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000079308.16
HGNCiHGNC:11973 TNS1
MIMi600076 gene
neXtProtiNX_Q9HBL0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi7145
OpenTargetsiENSG00000079308
PharmGKBiPA36660

Polymorphism and mutation databases

BioMutaiTNS1
DMDMi212276466

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002159001 – 1735Tensin-1Add BLAST1735

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei338PhosphoserineCombined sources1
Modified residuei364PhosphoserineCombined sources1
Modified residuei366PhosphotyrosineCombined sources1
Modified residuei378PhosphoserineCombined sources1
Modified residuei379PhosphothreonineCombined sources1
Modified residuei433PhosphoserineCombined sources1
Modified residuei621PhosphoserineCombined sources1
Modified residuei701PhosphoserineCombined sources1
Modified residuei764PhosphoserineCombined sources1
Modified residuei769PhosphoserineCombined sources1
Modified residuei794PhosphoserineCombined sources1
Modified residuei860PhosphothreonineCombined sources1
Modified residuei899PhosphoserineCombined sources1
Modified residuei903PhosphotyrosineCombined sources1
Modified residuei907PhosphoserineCombined sources1
Modified residuei963PhosphoserineCombined sources1
Modified residuei967PhosphoserineCombined sources1
Modified residuei1124PhosphoserineCombined sources1
Modified residuei1177PhosphoserineCombined sources1 Publication1
Modified residuei1189PhosphothreonineCombined sources1
Modified residuei1192PhosphoserineCombined sources1
Modified residuei1266PhosphothreonineCombined sources1
Modified residuei1269PhosphoserineCombined sources1
Modified residuei1294PhosphoserineCombined sources1
Modified residuei1309PhosphoserineCombined sources1
Modified residuei1314PhosphoserineCombined sources1
Modified residuei1381PhosphoserineCombined sources1
Modified residuei1393PhosphoserineCombined sources1
Modified residuei1400PhosphoserineCombined sources1
Modified residuei1446PhosphoserineCombined sources1
Modified residuei1588PhosphoserineCombined sources1

Post-translational modificationi

Rapidly cleaved by calpain II.

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9HBL0
MaxQBiQ9HBL0
PaxDbiQ9HBL0
PeptideAtlasiQ9HBL0
PRIDEiQ9HBL0
ProteomicsDBi81568

PTM databases

CarbonylDBiQ9HBL0
DEPODiQ9HBL0
iPTMnetiQ9HBL0
PhosphoSitePlusiQ9HBL0

Miscellaneous databases

PMAP-CutDBiQ9HBL0

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000079308 Expressed in 244 organ(s), highest expression level in blood vessel layer
CleanExiHS_TNS1
ExpressionAtlasiQ9HBL0 baseline and differential
GenevisibleiQ9HBL0 HS

Organism-specific databases

HPAiCAB018774
HPA036089
HPA036090

Interactioni

Subunit structurei

Binds to actin filaments and interacts with phosphotyrosine-containing proteins. Interacts with STARD8.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112999, 19 interactors
DIPiDIP-60948N
IntActiQ9HBL0, 11 interactors
MINTiQ9HBL0
STRINGi9606.ENSP00000171887

Structurei

3D structure databases

ProteinModelPortaliQ9HBL0
SMRiQ9HBL0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 176Phosphatase tensin-typePROSITE-ProRule annotationAdd BLAST173
Domaini181 – 307C2 tensin-typePROSITE-ProRule annotationAdd BLAST127
Domaini1463 – 1572SH2PROSITE-ProRule annotationAdd BLAST110

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi651 – 667Gln-richAdd BLAST17
Compositional biasi1069 – 1160Ser-richAdd BLAST92

Keywords - Domaini

SH2 domain

Phylogenomic databases

eggNOGiKOG1930 Eukaryota
KOG2283 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00760000119113
HOGENOMiHOG000060090
HOVERGENiHBG060186
InParanoidiQ9HBL0
KOiK18080
OMAiRMSMGDR
OrthoDBiEOG091G0G8Y
PhylomeDBiQ9HBL0
TreeFamiTF315996

Family and domain databases

CDDicd01213 PTB_tensin, 1 hit
cd09927 SH2_Tensin_like, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR029021 Prot-tyrosine_phosphatase-like
IPR013625 PTB
IPR006020 PTB/PI_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR014020 Tensin_C2-dom
IPR035012 Tensin_like_SH2
IPR029023 Tensin_phosphatase
IPR033929 Tensin_PTB
IPR003595 Tyr_Pase_cat
PfamiView protein in Pfam
PF08416 PTB, 1 hit
PF10409 PTEN_C2, 1 hit
PF00017 SH2, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM01326 PTEN_C2, 1 hit
SM00404 PTPc_motif, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51181 PPASE_TENSIN, 1 hit
PS50001 SH2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HBL0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVSRTMEDS CELDLVYVTE RIIAVSFPST ANEENFRSNL REVAQMLKSK
60 70 80 90 100
HGGNYLLFNL SERRPDITKL HAKVLEFGWP DLHTPALEKI CSICKAMDTW
110 120 130 140 150
LNADPHNVVV LHNKGNRGRI GVVIAAYMHY SNISASADQA LDRFAMKRFY
160 170 180 190 200
EDKIVPIGQP SQRRYVHYFS GLLSGSIKMN NKPLFLHHVI MHGIPNFESK
210 220 230 240 250
GGCRPFLRIY QAMQPVYTSG IYNIPGDSQT SVCITIEPGL LLKGDILLKC
260 270 280 290 300
YHKKFRSPAR DVIFRVQFHT CAIHDLGVVF GKEDLDDAFK DDRFPEYGKV
310 320 330 340 350
EFVFSYGPEK IQGMEHLENG PSVSVDYNTS DPLIRWDSYD NFSGHRDDGM
360 370 380 390 400
EEVVGHTQGP LDGSLYAKVK KKDSLHGSTG AVNATRPTLS ATPNHVEHTL
410 420 430 440 450
SVSSDSGNST ASTKTDKTDE PVPGASSATA ALSPQEKREL DRLLSGFGLE
460 470 480 490 500
REKQGAMYHT QHLRSRPAGG SAVPSSGRHV VPAQVHVNGG ALASERETDI
510 520 530 540 550
LDDELPNQDG HSAGSMGTLS SLDGVTNTSE GGYPEALSPL TNGLDKSYPM
560 570 580 590 600
EPMVNGGGYP YESASRAGPA HAGHTAPMRP SYSAQEGLAG YQREGPHPAW
610 620 630 640 650
PQPVTTSHYA HDPSGMFRSQ SFSEAEPQLP PAPVRGGSSR EAVQRGLNSW
660 670 680 690 700
QQQQQQQQQP RPPPRQQERA HLESLVASRP SPQPLAETPI PSLPEFPRAA
710 720 730 740 750
SQQEIEQSIE TLNMLMLDLE PASAAAPLHK SQSVPGAWPG ASPLSSQPLS
760 770 780 790 800
GSSRQSHPLT QSRSGYIPSG HSLGTPEPAP RASLESVPPG RSYSPYDYQP
810 820 830 840 850
CLAGPNQDFH SKSPASSSLP AFLPTTHSPP GPQQPPASLP GLTAQPLLSP
860 870 880 890 900
KEATSDPSRT PEEEPLNLEG LVAHRVAGVQ AREKQPAEPP APLRRRAASD
910 920 930 940 950
GQYENQSPEA TSPRSPGVRS PVQCVSPELA LTIALNPGGR PKEPHLHSYK
960 970 980 990 1000
EAFEEMEGTS PSSPPPSGVR SPPGLAKTPL SALGLKPHNP ADILLHPTGV
1010 1020 1030 1040 1050
TRRRIQPEED EGKVVVRLSE EPRSYVESVA RTAVAGPRAQ DSEPKSFSAP
1060 1070 1080 1090 1100
ATQAYGHEIP LRNGTLGGSF VSPSPLSTSS PILSADSTSV GSFPSGESSD
1110 1120 1130 1140 1150
QGPRTPTQPL LESGFRSGSL GQPSPSAQRN YQSSSPLPTV GSSYSSPDYS
1160 1170 1180 1190 1200
LQHFSSSPES QARAQFSVAG VHTVPGSPQA RHRTVGTNTP PSPGFGWRAI
1210 1220 1230 1240 1250
NPSMAAPSSP SLSHHQMMGP PGTGFHGSTV SSPQSSAATT PGSPSLCRHP
1260 1270 1280 1290 1300
AGVYQVSGLH NKVATTPGSP SLGRHPGAHQ GNLASGLHSN AIASPGSPSL
1310 1320 1330 1340 1350
GRHLGGSGSV VPGSPCLDRH VAYGGYSTPE DRRPTLSRQS SASGYQAPST
1360 1370 1380 1390 1400
PSFPVSPAYY PGLSSPATSP SPDSAAFRQG SPTPALPEKR RMSVGDRAGS
1410 1420 1430 1440 1450
LPNYATINGK VSSPVASGMS SPSGGSTVSF SHTLPDFSKY SMPDNSPETR
1460 1470 1480 1490 1500
AKVKFVQDTS KYWYKPEISR EQAIALLKDQ EPGAFIIRDS HSFRGAYGLA
1510 1520 1530 1540 1550
MKVSSPPPTI MQQNKKGDMT HELVRHFLIE TGPRGVKLKG CPNEPNFGSL
1560 1570 1580 1590 1600
SALVYQHSII PLALPCKLVI PNRDPTDESK DSSGPANSTA DLLKQGAACN
1610 1620 1630 1640 1650
VLFVNSVDME SLTGPQAISK ATSETLAADP TPAATIVHFK VSAQGITLTD
1660 1670 1680 1690 1700
NQRKLFFRRH YPLNTVTFCD LDPQERKWMK TEGGAPAKLF GFVARKQGST
1710 1720 1730
TDNACHLFAE LDPNQPASAI VNFVSKVMLN AGQKR
Length:1,735
Mass (Da):185,701
Last modified:November 4, 2008 - v2
Checksum:i90C173D5E371EF3E
GO
Isoform 2 (identifier: Q9HBL0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVPFQQRKDCVLEGSTRVTPSVQPHLQPIRNM
     352-385: EVVGHTQGPLDGSLYAKVKKKDSLHGSTGAVNAT → DGNKQNTNSQSIGSISGGLEDQYTWPDTHWPSQS
     386-1735: Missing.

Note: No experimental confirmation available.
Show »
Length:416
Mass (Da):47,240
Checksum:i372FC64F2304C63E
GO

Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ERH1E7ERH1_HUMAN
Tensin-1
TNS1
780Annotation score:
A0A2R8Y4T1A0A2R8Y4T1_HUMAN
Tensin-1
TNS1
1,860Annotation score:
E9PGF5E9PGF5_HUMAN
Tensin-1
TNS1
1,714Annotation score:
E9PF55E9PF55_HUMAN
Tensin-1
TNS1
1,721Annotation score:
H0Y4U1H0Y4U1_HUMAN
Tensin-1
TNS1
846Annotation score:
A0A087WWW7A0A087WWW7_HUMAN
Tensin-1
TNS1
1,365Annotation score:
E7EMG1E7EMG1_HUMAN
Tensin-1
TNS1
487Annotation score:
H7C3Z4H7C3Z4_HUMAN
Tensin-1
TNS1
149Annotation score:
C9JI43C9JI43_HUMAN
Tensin-1
TNS1
102Annotation score:
C9JFT7C9JFT7_HUMAN
Tensin-1
TNS1
61Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti179M → I in AAG33700 (PubMed:11023826).Curated1
Sequence conflicti1412S → A in AAG33700 (PubMed:11023826).Curated1
Sequence conflicti1416A → P in AAG33700 (PubMed:11023826).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_047066311I → M. Corresponds to variant dbSNP:rs11680854Ensembl.1
Natural variantiVAR_047067466R → C. Corresponds to variant dbSNP:rs3815849Ensembl.1
Natural variantiVAR_047068528T → I. Corresponds to variant dbSNP:rs3796033Ensembl.1
Natural variantiVAR_0470691004R → W. Corresponds to variant dbSNP:rs3796028Ensembl.1
Natural variantiVAR_0480041093F → L in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0470701197W → R Common polymorphism. Combined sources1 PublicationCorresponds to variant dbSNP:rs2571445Ensembl.1
Natural variantiVAR_0470711604V → I1 PublicationCorresponds to variant dbSNP:rs918949Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0563351M → MVPFQQRKDCVLEGSTRVTP SVQPHLQPIRNM in isoform 2. 1 Publication1
Alternative sequenceiVSP_056336352 – 385EVVGH…AVNAT → DGNKQNTNSQSIGSISGGLE DQYTWPDTHWPSQS in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_056337386 – 1735Missing in isoform 2. 1 PublicationAdd BLAST1350

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF225896 mRNA Translation: AAG33700.1
AC009469 Genomic DNA Translation: AAX88952.1
AC010136 Genomic DNA No translation available.
BC071905 mRNA Translation: AAH71905.1
CCDSiCCDS2407.1 [Q9HBL0-1]
RefSeqiNP_001294951.1, NM_001308022.1
NP_072174.3, NM_022648.5 [Q9HBL0-1]
UniGeneiHs.471381

Genome annotation databases

EnsembliENST00000171887; ENSP00000171887; ENSG00000079308 [Q9HBL0-1]
ENST00000310858; ENSP00000308321; ENSG00000079308 [Q9HBL0-2]
GeneIDi7145
KEGGihsa:7145
UCSCiuc002vgt.3 human [Q9HBL0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF225896 mRNA Translation: AAG33700.1
AC009469 Genomic DNA Translation: AAX88952.1
AC010136 Genomic DNA No translation available.
BC071905 mRNA Translation: AAH71905.1
CCDSiCCDS2407.1 [Q9HBL0-1]
RefSeqiNP_001294951.1, NM_001308022.1
NP_072174.3, NM_022648.5 [Q9HBL0-1]
UniGeneiHs.471381

3D structure databases

ProteinModelPortaliQ9HBL0
SMRiQ9HBL0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112999, 19 interactors
DIPiDIP-60948N
IntActiQ9HBL0, 11 interactors
MINTiQ9HBL0
STRINGi9606.ENSP00000171887

PTM databases

CarbonylDBiQ9HBL0
DEPODiQ9HBL0
iPTMnetiQ9HBL0
PhosphoSitePlusiQ9HBL0

Polymorphism and mutation databases

BioMutaiTNS1
DMDMi212276466

Proteomic databases

EPDiQ9HBL0
MaxQBiQ9HBL0
PaxDbiQ9HBL0
PeptideAtlasiQ9HBL0
PRIDEiQ9HBL0
ProteomicsDBi81568

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000171887; ENSP00000171887; ENSG00000079308 [Q9HBL0-1]
ENST00000310858; ENSP00000308321; ENSG00000079308 [Q9HBL0-2]
GeneIDi7145
KEGGihsa:7145
UCSCiuc002vgt.3 human [Q9HBL0-1]

Organism-specific databases

CTDi7145
DisGeNETi7145
EuPathDBiHostDB:ENSG00000079308.16
GeneCardsiTNS1
H-InvDBiHIX0002818
HGNCiHGNC:11973 TNS1
HPAiCAB018774
HPA036089
HPA036090
MIMi600076 gene
neXtProtiNX_Q9HBL0
OpenTargetsiENSG00000079308
PharmGKBiPA36660
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1930 Eukaryota
KOG2283 Eukaryota
COG2453 LUCA
GeneTreeiENSGT00760000119113
HOGENOMiHOG000060090
HOVERGENiHBG060186
InParanoidiQ9HBL0
KOiK18080
OMAiRMSMGDR
OrthoDBiEOG091G0G8Y
PhylomeDBiQ9HBL0
TreeFamiTF315996

Enzyme and pathway databases

SignaLinkiQ9HBL0

Miscellaneous databases

ChiTaRSiTNS1 human
GeneWikiiTNS1
GenomeRNAii7145
PMAP-CutDBiQ9HBL0
PROiPR:Q9HBL0
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000079308 Expressed in 244 organ(s), highest expression level in blood vessel layer
CleanExiHS_TNS1
ExpressionAtlasiQ9HBL0 baseline and differential
GenevisibleiQ9HBL0 HS

Family and domain databases

CDDicd01213 PTB_tensin, 1 hit
cd09927 SH2_Tensin_like, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR029021 Prot-tyrosine_phosphatase-like
IPR013625 PTB
IPR006020 PTB/PI_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR014020 Tensin_C2-dom
IPR035012 Tensin_like_SH2
IPR029023 Tensin_phosphatase
IPR033929 Tensin_PTB
IPR003595 Tyr_Pase_cat
PfamiView protein in Pfam
PF08416 PTB, 1 hit
PF10409 PTEN_C2, 1 hit
PF00017 SH2, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM01326 PTEN_C2, 1 hit
SM00404 PTPc_motif, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51181 PPASE_TENSIN, 1 hit
PS50001 SH2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTENS1_HUMAN
AccessioniPrimary (citable) accession number: Q9HBL0
Secondary accession number(s): Q4ZG71, Q6IPI5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: November 4, 2008
Last modified: November 7, 2018
This is version 157 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again