Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-parvin

Gene

PARVB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein that plays a role in integrin signaling via ILK and in activation of the GTPases CDC42 and RAC1 by guanine exchange factors, such as ARHGEF6. Is involved in the reorganization of the actin cytoskeleton and formation of lamellipodia. Plays a role in cell adhesion, cell spreading, establishment or maintenance of cell polarity, and cell migration.5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding
Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-446353 Cell-extracellular matrix interactions
R-HSA-446388 Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Beta-parvin
Alternative name(s):
Affixin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PARVB
ORF Names:CGI-56
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000188677.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14653 PARVB

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608121 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HBI1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi256V → Q: Abolishes interaction with PXN. 1 Publication1
Mutagenesisi299F → D: Abolishes interaction with ILK. Abolishes location at focal adhesion sites. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
29780

Open Targets

More...
OpenTargetsi
ENSG00000188677

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA32951

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PARVB

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20139178

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001215831 – 364Beta-parvinAdd BLAST364

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei7PhosphoserineCombined sources1
Modified residuei54PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HBI1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HBI1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HBI1

PeptideAtlas

More...
PeptideAtlasi
Q9HBI1

PRoteomics IDEntifications database

More...
PRIDEi
Q9HBI1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81559
81560 [Q9HBI1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HBI1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HBI1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in heart and skeletal muscle.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188677 Expressed in 187 organ(s), highest expression level in muscle of leg

CleanEx database of gene expression profiles

More...
CleanExi
HS_PARVB

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HBI1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HBI1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA062601

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DYSF. Interacts with ILK, ARHGEF6, PXN (via LD motifs), ACTN2 and actin.7 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118912, 10 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9HBI1

Protein interaction database and analysis system

More...
IntActi
Q9HBI1, 8 interactors

Molecular INTeraction database

More...
MINTi
Q9HBI1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000384515

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1364
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9HBI1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HBI1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini87 – 194Calponin-homology (CH) 1PROSITE-ProRule annotationAdd BLAST108
Domaini254 – 361Calponin-homology (CH) 2PROSITE-ProRule annotationAdd BLAST108

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the parvin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3631 Eukaryota
ENOG410XQWH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154033

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000247027

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053517

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HBI1

KEGG Orthology (KO)

More...
KOi
K06275

Identification of Orthologs from Complete Genome Data

More...
OMAi
GLLQTTH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0ULB

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HBI1

TreeFam database of animal gene trees

More...
TreeFami
TF314025

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR028433 Parvin

The PANTHER Classification System

More...
PANTHERi
PTHR12114 PTHR12114, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00307 CH, 2 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF039131 Parvin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00033 CH, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47576 SSF47576, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50021 CH, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HBI1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSAPRSPTP RPRRMKKDES FLGKLGGTLA RKRRAREVSD LQEEGKNAIN
60 70 80 90 100
SPMSPALVDV HPEDTQLEEN EERTMIDPTS KEDPKFKELV KVLLDWINDV
110 120 130 140 150
LVEERIIVKQ LEEDLYDGQV LQKLLEKLAG CKLNVAEVTQ SEIGQKQKLQ
160 170 180 190 200
TVLEAVHDLL RPRGWALRWS VDSIHGKNLV AILHLLVSLA MHFRAPIRLP
210 220 230 240 250
EHVTVQVVVV RKREGLLHSS HISEELTTTT EMMMGRFERD AFDTLFDHAP
260 270 280 290 300
DKLSVVKKSL ITFVNKHLNK LNLEVTELET QFADGVYLVL LMGLLEDYFV
310 320 330 340 350
PLHHFYLTPE SFDQKVHNVS FAFELMLDGG LKKPKARPED VVNLDLKSTL
360
RVLYNLFTKY KNVE
Length:364
Mass (Da):41,714
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4BA4B50C83083DC7
GO
Isoform 2 (identifier: Q9HBI1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MSSAPRSPTP...TLARKRRARE → MHHVFKDHQR...VETSEYAQGG

Show »
Length:397
Mass (Da):45,183
Checksum:iBA4335437824E465
GO
Isoform 3 (identifier: Q9HBI1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREV → M

Note: No experimental confirmation available.
Show »
Length:327
Mass (Da):37,538
Checksum:iBD4A2F8D5ECD7768
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WZB5A0A087WZB5_HUMAN
Beta-parvin
PARVB
289Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0QYP8B0QYP8_HUMAN
Beta-parvin
PARVB
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD34051 differs from that shown. Reason: Frameshift at positions 4, 14, 48, 58, 155, 162, 171, 327, 331 and 344.Curated
The sequence BG743702 differs from that shown. Reason: Frameshift at positions 136, 232 and 237.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti27G → V in AAD34051 (PubMed:10810093).Curated1
Sequence conflicti59D → M in AAD34051 (PubMed:10810093).Curated1
Sequence conflicti349T → P in AAD34051 (PubMed:10810093).Curated1
Isoform 2 (identifier: Q9HBI1-2)
Sequence conflicti4V → G in BG743702 (PubMed:15489334).Curated1
Sequence conflicti21N → K in AAL08219 (Ref. 1) Curated1
Sequence conflicti37W → R in AAL08219 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03436952P → R. Corresponds to variant dbSNP:rs34476853Ensembl.1
Natural variantiVAR_01724258V → ACombined sources3 PublicationsCorresponds to variant dbSNP:rs1983609Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0455551 – 38MSSAP…RAREV → M in isoform 3. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_0413361 – 37MSSAP…RRARE → MHHVFKDHQRGEKRGFLSPE NKNCRRLELRRGCSCSWGLC SQALMASLAGSLLPGSDRSG VETSEYAQGG in isoform 2. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF303887 mRNA Translation: AAL08219.1
AB048276 mRNA Translation: BAB62077.1
AF237769 mRNA Translation: AAG27171.1
AF151814 mRNA Translation: AAD34051.1 Frameshift.
AK313957 mRNA Translation: BAG36673.1
AL031595 Genomic DNA No translation available.
AL033543 Genomic DNA No translation available.
Z82178 Genomic DNA No translation available.
Z82174 Genomic DNA No translation available.
AL035398 Genomic DNA No translation available.
CH471138 Genomic DNA Translation: EAW73328.1
BC039811 mRNA No translation available.
BC046103 mRNA Translation: AAH46103.2
BG743702 mRNA No translation available.
AL159142 mRNA Translation: CAB76900.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14056.1 [Q9HBI1-1]
CCDS46724.1 [Q9HBI1-2]
CCDS58808.1 [Q9HBI1-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001003828.1, NM_001003828.2 [Q9HBI1-2]
NP_001230314.1, NM_001243385.1 [Q9HBI1-3]
NP_001230315.1, NM_001243386.1
NP_037459.2, NM_013327.4 [Q9HBI1-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.475074

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000338758; ENSP00000342492; ENSG00000188677 [Q9HBI1-1]
ENST00000404989; ENSP00000384353; ENSG00000188677 [Q9HBI1-3]
ENST00000406477; ENSP00000384515; ENSG00000188677 [Q9HBI1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29780

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29780

UCSC genome browser

More...
UCSCi
uc003bem.4 human [Q9HBI1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF303887 mRNA Translation: AAL08219.1
AB048276 mRNA Translation: BAB62077.1
AF237769 mRNA Translation: AAG27171.1
AF151814 mRNA Translation: AAD34051.1 Frameshift.
AK313957 mRNA Translation: BAG36673.1
AL031595 Genomic DNA No translation available.
AL033543 Genomic DNA No translation available.
Z82178 Genomic DNA No translation available.
Z82174 Genomic DNA No translation available.
AL035398 Genomic DNA No translation available.
CH471138 Genomic DNA Translation: EAW73328.1
BC039811 mRNA No translation available.
BC046103 mRNA Translation: AAH46103.2
BG743702 mRNA No translation available.
AL159142 mRNA Translation: CAB76900.1
CCDSiCCDS14056.1 [Q9HBI1-1]
CCDS46724.1 [Q9HBI1-2]
CCDS58808.1 [Q9HBI1-3]
RefSeqiNP_001003828.1, NM_001003828.2 [Q9HBI1-2]
NP_001230314.1, NM_001243385.1 [Q9HBI1-3]
NP_001230315.1, NM_001243386.1
NP_037459.2, NM_013327.4 [Q9HBI1-1]
UniGeneiHs.475074

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4EDLX-ray2.10A/B/C/D/E/F235-364[»]
4EDMX-ray2.00A/B235-364[»]
4EDNX-ray2.90A/B/C/D/E/F/G/H/I/J235-364[»]
ProteinModelPortaliQ9HBI1
SMRiQ9HBI1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118912, 10 interactors
CORUMiQ9HBI1
IntActiQ9HBI1, 8 interactors
MINTiQ9HBI1
STRINGi9606.ENSP00000384515

PTM databases

iPTMnetiQ9HBI1
PhosphoSitePlusiQ9HBI1

Polymorphism and mutation databases

BioMutaiPARVB
DMDMi20139178

Proteomic databases

EPDiQ9HBI1
MaxQBiQ9HBI1
PaxDbiQ9HBI1
PeptideAtlasiQ9HBI1
PRIDEiQ9HBI1
ProteomicsDBi81559
81560 [Q9HBI1-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338758; ENSP00000342492; ENSG00000188677 [Q9HBI1-1]
ENST00000404989; ENSP00000384353; ENSG00000188677 [Q9HBI1-3]
ENST00000406477; ENSP00000384515; ENSG00000188677 [Q9HBI1-2]
GeneIDi29780
KEGGihsa:29780
UCSCiuc003bem.4 human [Q9HBI1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29780
DisGeNETi29780
EuPathDBiHostDB:ENSG00000188677.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PARVB
HGNCiHGNC:14653 PARVB
HPAiHPA062601
MIMi608121 gene
neXtProtiNX_Q9HBI1
OpenTargetsiENSG00000188677
PharmGKBiPA32951

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3631 Eukaryota
ENOG410XQWH LUCA
GeneTreeiENSGT00940000154033
HOGENOMiHOG000247027
HOVERGENiHBG053517
InParanoidiQ9HBI1
KOiK06275
OMAiGLLQTTH
OrthoDBiEOG091G0ULB
PhylomeDBiQ9HBI1
TreeFamiTF314025

Enzyme and pathway databases

ReactomeiR-HSA-446353 Cell-extracellular matrix interactions
R-HSA-446388 Regulation of cytoskeletal remodeling and cell spreading by IPP complex components

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PARVB

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29780

Protein Ontology

More...
PROi
PR:Q9HBI1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000188677 Expressed in 187 organ(s), highest expression level in muscle of leg
CleanExiHS_PARVB
ExpressionAtlasiQ9HBI1 baseline and differential
GenevisibleiQ9HBI1 HS

Family and domain databases

Gene3Di1.10.418.10, 2 hits
InterProiView protein in InterPro
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR028433 Parvin
PANTHERiPTHR12114 PTHR12114, 1 hit
PfamiView protein in Pfam
PF00307 CH, 2 hits
PIRSFiPIRSF039131 Parvin, 1 hit
SMARTiView protein in SMART
SM00033 CH, 2 hits
SUPFAMiSSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPARVB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HBI1
Secondary accession number(s): B0QYM8
, B0QYN1, B2R9X6, Q5TGJ5, Q86X93, Q96PN1, Q9NSP7, Q9UGT3, Q9Y368, Q9Y3L6, Q9Y3L7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: March 1, 2001
Last modified: December 5, 2018
This is version 162 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again