Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

p53-induced death domain-containing protein 1

Gene

PIDD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Promotes apoptosis downstream of the tumor suppressor as component of the DNA damage/stress response pathway that connects p53/TP53 to apoptosis. Associates with NEMO/IKBKG and RIP1 and enhances sumoylation and ubiquitination of NEMO/IKBKG which is important for activation of the transcription factor NF-kappa-B. Associates with CASP2/caspase-2 and CRADD/RAIDD, and induces activation of CASP2 which an important regulator in apoptotic pathways.3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei444PROSITE-ProRule annotation1
Active sitei446PROSITE-ProRule annotation1
Active sitei586PROSITE-ProRule annotation1
Active sitei588PROSITE-ProRule annotation1

GO - Molecular functioni

  • death receptor binding Source: ProtInc

GO - Biological processi

Keywordsi

Biological processApoptosis

Enzyme and pathway databases

ReactomeiR-HSA-6803207 TP53 Regulates Transcription of Caspase Activators and Caspases
SignaLinkiQ9HB75

Protein family/group databases

MEROPSiS68.001

Names & Taxonomyi

Protein namesi
Recommended name:
p53-induced death domain-containing protein 1
Alternative name(s):
Leucine-rich repeat and death domain-containing protein
Gene namesi
Name:PIDD1
Synonyms:LRDD, PIDD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000177595.17
HGNCiHGNC:16491 PIDD1
MIMi605247 gene
neXtProtiNX_Q9HB75

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi55367
OpenTargetsiENSG00000177595
PharmGKBiPA30445

Polymorphism and mutation databases

BioMutaiPIDD
DMDMi116242715

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00002452432 – 910p53-induced death domain-containing protein 1Add BLAST909

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanine1 Publication1
Modified residuei299Phosphoserine1 Publication1
Modified residuei305Phosphoserine1 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9HB75
PeptideAtlasiQ9HB75
PRIDEiQ9HB75
ProteomicsDBi81501
81502 [Q9HB75-2]
81503 [Q9HB75-3]
81504 [Q9HB75-4]
81505 [Q9HB75-5]
81506 [Q9HB75-6]
81507 [Q9HB75-7]

PTM databases

iPTMnetiQ9HB75
PhosphoSitePlusiQ9HB75

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Inductioni

Induced by gamma-irradiation.1 Publication

Gene expression databases

BgeeiENSG00000177595 Expressed in 166 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiQ9HB75 baseline and differential
GenevisibleiQ9HB75 HS

Organism-specific databases

HPAiCAB012647
HPA055473

Interactioni

Subunit structurei

Interacts with FADD and MAP-kinase activating death domain/MADD. Forms a complex with IKBKG and with receptor-interacting serine-threonine kinase 1/RIP1. Forms also a complex named PIDDosome with CASP2 and CRADD.4 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120645, 37 interactors
CORUMiQ9HB75
IntActiQ9HB75, 14 interactors
MINTiQ9HB75
STRINGi9606.ENSP00000337797

Structurei

Secondary structure

1910
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9HB75
SMRiQ9HB75
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9HB75

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati126 – 147LRR 1Add BLAST22
Repeati149 – 171LRR 2Add BLAST23
Repeati172 – 194LRR 3Add BLAST23
Repeati195 – 216LRR 4Add BLAST22
Repeati218 – 240LRR 5Add BLAST23
Repeati241 – 263LRR 6Add BLAST23
Repeati264 – 285LRR 7Add BLAST22
Domaini322 – 454ZU5 1PROSITE-ProRule annotationAdd BLAST133
Domaini455 – 596ZU5 2PROSITE-ProRule annotationAdd BLAST142
Domaini788 – 873DeathPROSITE-ProRule annotationAdd BLAST86

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni423 – 452Peptidase S68PROSITE-ProRule annotationAdd BLAST30
Regioni566 – 594Peptidase S68PROSITE-ProRule annotationAdd BLAST29
Regioni580 – 716UPA domainBy similarityAdd BLAST137

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG0619 Eukaryota
KOG4177 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00920000148937
HOVERGENiHBG066762
InParanoidiQ9HB75
KOiK10130
OMAiVPHFSWF
OrthoDBiEOG091G01ZE
PhylomeDBiQ9HB75
TreeFamiTF331183

Family and domain databases

Gene3Di3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR019502 Peptidase_S68_pidd
IPR000906 ZU5_dom
PfamiView protein in Pfam
PF00531 Death, 1 hit
PF13855 LRR_8, 2 hits
PF10461 Peptidase_S68, 1 hit
PF00791 ZU5, 2 hits
SMARTiView protein in SMART
SM00005 DEATH, 1 hit
SM00369 LRR_TYP, 7 hits
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50017 DEATH_DOMAIN, 1 hit
PS51450 LRR, 7 hits
PS51145 ZU5, 2 hits

Sequences (7+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q9HB75-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAATVEGPEL EAAAAAGDAS EDSDAGSRAL PFLGGNRLSL DLYPGGCQQL
60 70 80 90 100
LHLCVQQPLQ LLQVEFLRLS THEDPQLLEA TLAQLPQSLS CLRSLVLKGG
110 120 130 140 150
QRRDTLGACL RGALTNLPAG LSGLAHLAHL DLSFNSLETL PACVLQMRGL
160 170 180 190 200
GALLLSHNCL SELPEALGAL PALTFLTVTH NRLQTLPPAL GALSTLQRLD
210 220 230 240 250
LSQNLLDTLP PEIGGLGSLL ELNLASNRLQ SLPASLAGLR SLRLLVLHSN
260 270 280 290 300
LLASVPADLA RLPLLTRLDL RDNQLRDLPP ELLDAPFVRL QGNPLGEASP
310 320 330 340 350
DAPSSPVAAL IPEMPRLFLT SDLDSFPVTP QGCSVTLACG VRLQFPAGAT
360 370 380 390 400
ATPITIRYRL LLPEPGLVPL GPHDALLSHV LELQPHGVAF QQDVGLWLLF
410 420 430 440 450
TPPQARRCRE VVVRTRNDNS WGDLETYLEE EAPQRLWAHC QVPHFSWFLV
460 470 480 490 500
VSRPVSNACL VPPEGTLLCS SGHPGVKVIF PPGATEEPRR VSMQVVRMAG
510 520 530 540 550
RELQALLGEP EAAVSPLLCL SQSGPPSFLQ PVTVQLPLPS GITGLSLDRS
560 570 580 590 600
RLHLLYWAPP AATWDDITAQ VVLELTHLYA RFQVTHFSWY WLWYTTKNCV
610 620 630 640 650
GGLARKAWER LRLHRVNLIA LQRRRDPEQV LLQCLPRNKV DATLRRLLER
660 670 680 690 700
YRGPEPSDTV EMFEGEEFFA AFERGIDVDA DRPDCVEGRI CFVFYSHLKN
710 720 730 740 750
VKEVYVTTTL DREAQAVRGQ VSFYRGAVPV RVPEEAEAAR QRKGADALWM
760 770 780 790 800
ATLPIKLPRL RGSEGPRRGA GLSLAPLNLG DAETGFLTQS NLLSVAGRLG
810 820 830 840 850
LDWPAVALHL GVSYREVQRI RHEFRDDLDE QIRHMLFSWA ERQAGQPGAV
860 870 880 890 900
GLLVQALEQS DRQDVAEEVR AVLELGRRKY QDSIRRMGLA PKDPALPGSS
910
APQPPEPAQA
Length:910
Mass (Da):99,712
Last modified:October 17, 2006 - v2
Checksum:i8C98FC64230B57F8
GO
Isoform 2 (identifier: Q9HB75-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     704-720: Missing.

Show »
Length:893
Mass (Da):97,823
Checksum:i426694FB8EC10235
GO
Isoform 3 (identifier: Q9HB75-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.
     579-589: Missing.

Show »
Length:753
Mass (Da):82,971
Checksum:i6BD2B00A12B574DC
GO
Isoform 4 (identifier: Q9HB75-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-313: Missing.

Show »
Length:597
Mass (Da):66,720
Checksum:i2572BA6345C426AA
GO
Isoform 5 (identifier: Q9HB75-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-313: Missing.
     589-589: W → WSVPPSFLSPPPPVCTALLTPSSPR
     759-815: RLRGSEGPRR...VALHLGVSYR → VGLRDSRGAG...GGGLASPWHP
     816-910: Missing.

Show »
Length:526
Mass (Da):58,652
Checksum:iACB01B6B05784BF1
GO
Isoform 6 (identifier: Q9HB75-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-492: Missing.
     589-589: W → WSVPPSFLSPPPPVCTALLTPSSPR
     704-720: Missing.
     759-815: RLRGSEGPRR...VALHLGVSYR → VGLRDSRGAG...GGGLASPWHP
     816-910: Missing.

Show »
Length:330
Mass (Da):37,019
Checksum:i1A8F34F669B0F38A
GO
Isoform 7 (identifier: Q9HB75-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-313: Missing.
     585-621: THFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIAL → LALVHHQELCGRPGSEGLGAAAAAPCEPHRSAAAPGP
     622-910: Missing.

Show »
Length:308
Mass (Da):33,375
Checksum:i5E814E02D2E0E4CB
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YE55H0YE55_HUMAN
p53-induced death domain-containing...
PIDD1
338Annotation score:
E9PPT6E9PPT6_HUMAN
p53-induced death domain-containing...
PIDD1
108Annotation score:

Sequence cautioni

The sequence BAD92069 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD92186 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD92766 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD38708 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti335V → A in BAC11272 (PubMed:14702039).Curated1
Sequence conflicti421W → L in AAP97716 (Ref. 3) Curated1
Sequence conflicti492S → F in BAC11272 (PubMed:14702039).Curated1
Sequence conflicti512A → V in CAD38708 (PubMed:17974005).Curated1
Sequence conflicti601G → E in CAD38708 (PubMed:17974005).Curated1
Sequence conflicti895A → V in AAF69491 (PubMed:10825539).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_028031331Q → R7 PublicationsCorresponds to variant dbSNP:rs10902221Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0196641 – 492Missing in isoform 6. 1 PublicationAdd BLAST492
Alternative sequenceiVSP_0196651 – 313Missing in isoform 4, isoform 5 and isoform 7. 4 PublicationsAdd BLAST313
Alternative sequenceiVSP_0196661 – 146Missing in isoform 3. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_019667579 – 589Missing in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_019668585 – 621THFSW…NLIAL → LALVHHQELCGRPGSEGLGA AAAAPCEPHRSAAAPGP in isoform 7. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_019669589W → WSVPPSFLSPPPPVCTALLT PSSPR in isoform 5 and isoform 6. 2 Publications1
Alternative sequenceiVSP_019670622 – 910Missing in isoform 7. 1 PublicationAdd BLAST289
Alternative sequenceiVSP_019671704 – 720Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_019672759 – 815RLRGS…GVSYR → VGLRDSRGAGQDRGPGVTRV TWWSWGWSPGLNALFPSNRD FEGPRGHGGGLASPWHP in isoform 5 and isoform 6. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_019673816 – 910Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST95

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF229178 mRNA Translation: AAF69491.1
AF274972 mRNA Translation: AAG13461.1
AF465246 mRNA Translation: AAP97716.1
AK074893 mRNA Translation: BAC11272.1
AB208832 mRNA Translation: BAD92069.1 Different initiation.
AB208949 mRNA Translation: BAD92186.1 Different initiation.
AB209529 mRNA Translation: BAD92766.1 Different initiation.
AL833849 mRNA Translation: CAD38708.1 Different initiation.
BC014904 mRNA Translation: AAH14904.1
CCDSiCCDS44508.1 [Q9HB75-2]
CCDS7716.1 [Q9HB75-1]
RefSeqiNP_665893.2, NM_145886.3 [Q9HB75-1]
NP_665894.2, NM_145887.3 [Q9HB75-2]
XP_011518512.1, XM_011520210.2 [Q9HB75-1]
XP_011518513.1, XM_011520211.2 [Q9HB75-2]
XP_016873482.1, XM_017017993.1 [Q9HB75-4]
UniGeneiHs.592290

Genome annotation databases

EnsembliENST00000347755; ENSP00000337797; ENSG00000177595 [Q9HB75-1]
ENST00000411829; ENSP00000416801; ENSG00000177595 [Q9HB75-2]
GeneIDi55367
KEGGihsa:55367
UCSCiuc001lro.3 human [Q9HB75-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPIDD1_HUMAN
AccessioniPrimary (citable) accession number: Q9HB75
Secondary accession number(s): Q59FD1
, Q59H10, Q59HC7, Q7Z4P8, Q8NC89, Q8NDL2, Q96C25, Q9NRE6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: October 17, 2006
Last modified: September 12, 2018
This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again