Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Claspin

Gene

CLSPN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for checkpoint mediated cell cycle arrest in response to inhibition of DNA replication or to DNA damage induced by both ionizing and UV irradiation. Adapter protein which binds to BRCA1 and the checkpoint kinase CHEK1 and facilitates the ATR-dependent phosphorylation of both proteins. Can also bind specifically to branched DNA structures and may associate with S-phase chromatin following formation of the pre-replication complex (pre-RC). This may indicate a role for this protein as a sensor which monitors the integrity of DNA replication forks.5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • anaphase-promoting complex binding Source: UniProtKB
  • DNA binding Source: UniProtKB-KW

GO - Biological processi

  • activation of protein kinase activity Source: UniProtKB
  • DNA damage checkpoint Source: UniProtKB
  • DNA repair Source: UniProtKB-KW
  • DNA replication Source: Reactome
  • mitotic DNA replication checkpoint Source: UniProtKB
  • mitotic G2 DNA damage checkpoint Source: UniProtKB
  • peptidyl-serine phosphorylation Source: UniProtKB
  • protein deubiquitination Source: Reactome

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processCell cycle, DNA damage, DNA repair

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-5689880 Ub-specific processing proteases
R-HSA-5693607 Processing of DNA double-strand break ends

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9HAW4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Claspin
Short name:
hClaspin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CLSPN
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000092853.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19715 CLSPN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605434 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HAW4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi916T → A: Impairs interaction with CHEK1. 1 Publication1
Mutagenesisi945S → A: Impairs interaction with CHEK1. 1 Publication1
Mutagenesisi982S → A: No effect on interaction with CHEK1. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
63967

Open Targets

More...
OpenTargetsi
ENSG00000092853

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134920757

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CLSPN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
218512100

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000898751 – 1339ClaspinAdd BLAST1339

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei26PhosphoserineBy similarity1
Modified residuei42PhosphoserineBy similarity1
Modified residuei46PhosphoserineBy similarity1
Modified residuei53PhosphoserineBy similarity1
Modified residuei65PhosphoserineCombined sources1
Modified residuei67PhosphoserineCombined sources1
Modified residuei83PhosphoserineCombined sources1
Modified residuei110PhosphoserineBy similarity1
Modified residuei113PhosphoserineBy similarity1
Modified residuei225PhosphoserineCombined sources1
Modified residuei260PhosphoserineCombined sources1
Modified residuei516PhosphoserineCombined sources1
Modified residuei718PhosphoserineCombined sources1
Modified residuei720PhosphoserineCombined sources1
Modified residuei723PhosphoserineCombined sources1
Modified residuei731PhosphoserineCombined sources1
Modified residuei744PhosphoserineCombined sources1
Modified residuei762PhosphoserineCombined sources1
Modified residuei808PhosphoserineCombined sources1
Modified residuei810PhosphoserineCombined sources1
Modified residuei833PhosphoserineCombined sources1
Modified residuei839PhosphoserineCombined sources1
Modified residuei846PhosphoserineCombined sources1
Modified residuei891N6-acetyllysineCombined sources1
Modified residuei916Phosphothreonine; by CHEK11 Publication1
Modified residuei950PhosphoserineCombined sources1
Modified residuei954PhosphoserineCombined sources1
Modified residuei958PhosphoserineCombined sources1
Modified residuei1012PhosphoserineCombined sources1
Modified residuei1018PhosphoserineCombined sources1
Modified residuei1020PhosphoserineCombined sources1
Modified residuei1156PhosphoserineCombined sources1
Modified residuei1289PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Undergoes ATR-dependent phosphorylation by CHEK1 during activation of DNA replication or damage checkpoints. Phosphorylation by CSNK1G1/CK1 promotes CHEK1 binding.4 Publications
Ubiquitinated by the anaphase promoting complex/cyclosome (APC/C) during G1 phase, leading to its degradation by the proteasome. Ubiquitination is mediated via its interaction with FZR1/CDH1. Following DNA damage, it is deubiquitinated by USP28 in G2 phase, preventing its degradation.2 Publications

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HAW4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HAW4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9HAW4

PeptideAtlas

More...
PeptideAtlasi
Q9HAW4

PRoteomics IDEntifications database

More...
PRIDEi
Q9HAW4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
81451
81452 [Q9HAW4-2]
81453 [Q9HAW4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HAW4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HAW4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression peaks at S/G2 phases of the cell cycle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000092853 Expressed in 79 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_CLSPN

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HAW4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HAW4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA026305
HPA026312

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (phosphorylation-dependent) with CHEK1; regulates CLSPN function in checkpoint for DNA damage and replication. Interacts with ATR and RAD9A and these interactions are slightly reduced during checkpoint activation. Interacts with BRCA1 and this interaction increases during checkpoint activation. Interacts with TIMELESS.6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122015, 41 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9HAW4

Protein interaction database and analysis system

More...
IntActi
Q9HAW4, 22 interactors

Molecular INTeraction database

More...
MINTi
Q9HAW4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000312995

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9HAW4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HAW4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati910 – 919CKB motif 110
Repeati939 – 948CKB motif 210
Repeati976 – 985CKB motif 310

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili162 – 196Sequence analysisAdd BLAST35
Coiled coili592 – 681Sequence analysisAdd BLAST90

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminus of the protein contains 3 potential CHEK1-binding motifs (CKB motifs). Potential phosphorylation sites within CKB motif 1 and CKB motif 2 are required for interaction with CHEK1.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the claspin family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4156 Eukaryota
ENOG410Y041 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012738

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080104

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HAW4

Identification of Orthologs from Complete Genome Data

More...
OMAi
QDIREVR

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0CRX

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HAW4

TreeFam database of animal gene trees

More...
TreeFami
TF328925

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024146 Claspin

The PANTHER Classification System

More...
PANTHERi
PTHR14396 PTHR14396, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HAW4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTGEVGSEVH LEINDPNVIS QEEADSPSDS GQGSYETIGP LSEGDSDEEI
60 70 80 90 100
FVSKKLKNRK VLQDSDSETE DTNASPEKTT YDSAEEENKE NLYAGKNTKI
110 120 130 140 150
KRIYKTVADS DESYMEKSLY QENLEAQVKP CLELSLQSGN STDFTTDRKS
160 170 180 190 200
SKKHIHDKEG TAGKAKVKSK RRLEKEERKM EKIRQLKKKE TKNQEDDVEQ
210 220 230 240 250
PFNDSGCLLV DKDLFETGLE DENNSPLEDE ESLESIRAAV KNKVKKHKKK
260 270 280 290 300
EPSLESGVHS FEEGSELSKG TTRKERKAAR LSKEALKQLH SETQRLIRES
310 320 330 340 350
ALNLPYHMPE NKTIHDFFKR KPRPTCHGNA MALLKSSKYQ SSHHKEIIDT
360 370 380 390 400
ANTTEMNSDH HSKGSEQTTG AENEVETNAL PVVSKETQII TGSDESCRKD
410 420 430 440 450
LVKNEELEIQ EKQKQSDIRP SPGDSSVLQQ ESNFLGNNHS EECQVGGLVA
460 470 480 490 500
FEPHALEGEG PQNPEETDEK VEEPEQQNKS SAVGPPEKVR RFTLDRLKQL
510 520 530 540 550
GVDVSIKPRL GADEDSFVIL EPETNRELEA LKQRFWKHAN PAAKPRAGQT
560 570 580 590 600
VNVNVIVKDM GTDGKEELKA DVVPVTLAPK KLDGASHTKP GEKLQVLKAK
610 620 630 640 650
LQEAMKLRRF EERQKRQALF KLDNEDGFEE EEEEEEEMTD ESEEDGEEKV
660 670 680 690 700
EKEEKEEELE EEEEKEEEEE EEGNQETAEF LLSSEEIETK DEKEMDKENN
710 720 730 740 750
DGSSEIGKAV GFLSVPKSLS SDSTLLLFKD SSSKMGYFPT EEKSETDENS
760 770 780 790 800
GKQPSKLDED DSCSLLTKES SHNSSFELIG STIPSYQPCN RQTGRGTSFF
810 820 830 840 850
PTAGGFRSPS PGLFRASLVS SASKSSGKLS EPSLPIEDSQ DLYNASPEPK
860 870 880 890 900
TLFLGAGDFQ FCLEDDTQSQ LLDADGFLNV RNHRNQYQAL KPRLPLASMD
910 920 930 940 950
ENAMDANMDE LLDLCTGKFT SQAEKHLPRK SDKKENMEEL LNLCSGKFTS
960 970 980 990 1000
QDASTPASSE LNKQEKESSM GDPMEEALAL CSGSFPTDKE EEDEEEEFGD
1010 1020 1030 1040 1050
FRLVSNDNEF DSDEDEHSDS GNDLALEDHE DDDEEELLKR SEKLKRQMRL
1060 1070 1080 1090 1100
RKYLEDEAEV SGSDVGSEDE YDGEEIDEYE EDVIDEVLPS DEELQSQIKK
1110 1120 1130 1140 1150
IHMKTMLDDD KRQLRLYQER YLADGDLHSD GPGRMRKFRW KNIDDASQMD
1160 1170 1180 1190 1200
LFHRDSDDDQ TEEQLDESEA RWRKERIERE QWLRDMAQQG KITAEEEEEI
1210 1220 1230 1240 1250
GEDSQFMILA KKVTAKALQK NASRPMVIQE SKSLLRNPFE AIRPGSAQQV
1260 1270 1280 1290 1300
KTGSLLNQPK AVLQKLAALS DHNPSAPRNS RNFVFHTLSP VKAEAAKESS
1310 1320 1330
KSQVKKRGPS FMTSPSPKHL KTDDSTSGLT RSIFKYLES
Length:1,339
Mass (Da):151,094
Last modified:December 16, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3F3E392D5915955F
GO
Isoform 2 (identifier: Q9HAW4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     527-590: Missing.

Show »
Length:1,275
Mass (Da):144,167
Checksum:i5F02FE258D856D5C
GO
Isoform 3 (identifier: Q9HAW4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1304-1339: VKKRGPSFMTSPSPKHLKTDDSTSGLTRSIFKYLES → KIPEKDSDWLTWSGAPIPGFFRLSFDPHG

Show »
Length:1,332
Mass (Da):150,368
Checksum:i6FF64D7891BB7484
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7ESG2E7ESG2_HUMAN
Claspin
CLSPN
1,286Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH38991 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAH62215 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti34S → G in AAI15026 (PubMed:15489334).Curated1
Sequence conflicti446G → E in AAI15026 (PubMed:15489334).Curated1
Sequence conflicti628F → S in AAG24515 (PubMed:11090622).Curated1
Sequence conflicti664E → G in AAG24515 (PubMed:11090622).Curated1
Sequence conflicti738F → S in AAG24515 (PubMed:11090622).Curated1
Sequence conflicti931 – 933SDK → GDE in AAI15026 (PubMed:15489334).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035674439H → R in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_023439525N → S. Corresponds to variant dbSNP:rs7537203Ensembl.1
Natural variantiVAR_050867892P → T. Corresponds to variant dbSNP:rs34390044Ensembl.1
Natural variantiVAR_0508681280S → L. Corresponds to variant dbSNP:rs35490896Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_036033527 – 590Missing in isoform 2. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_0360341304 – 1339VKKRG…KYLES → KIPEKDSDWLTWSGAPIPGF FRLSFDPHG in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF297866 mRNA Translation: AAG24515.1
AL354864 Genomic DNA No translation available.
BC038991 mRNA Translation: AAH38991.1 Sequence problems.
BC062215 mRNA Translation: AAH62215.1 Sequence problems.
BC113116 mRNA Translation: AAI13117.1
BC115025 mRNA Translation: AAI15026.1
BC137279 mRNA Translation: AAI37280.1
BC140789 mRNA Translation: AAI40790.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS396.1 [Q9HAW4-1]
CCDS53297.1 [Q9HAW4-2]
CCDS81299.1 [Q9HAW4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001177410.1, NM_001190481.1 [Q9HAW4-2]
NP_001317419.1, NM_001330490.1 [Q9HAW4-3]
NP_071394.2, NM_022111.3 [Q9HAW4-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.175613

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000251195; ENSP00000251195; ENSG00000092853 [Q9HAW4-3]
ENST00000318121; ENSP00000312995; ENSG00000092853 [Q9HAW4-1]
ENST00000373220; ENSP00000362317; ENSG00000092853 [Q9HAW4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
63967

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:63967

UCSC genome browser

More...
UCSCi
uc001bzi.4 human [Q9HAW4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF297866 mRNA Translation: AAG24515.1
AL354864 Genomic DNA No translation available.
BC038991 mRNA Translation: AAH38991.1 Sequence problems.
BC062215 mRNA Translation: AAH62215.1 Sequence problems.
BC113116 mRNA Translation: AAI13117.1
BC115025 mRNA Translation: AAI15026.1
BC137279 mRNA Translation: AAI37280.1
BC140789 mRNA Translation: AAI40790.1
CCDSiCCDS396.1 [Q9HAW4-1]
CCDS53297.1 [Q9HAW4-2]
CCDS81299.1 [Q9HAW4-3]
RefSeqiNP_001177410.1, NM_001190481.1 [Q9HAW4-2]
NP_001317419.1, NM_001330490.1 [Q9HAW4-3]
NP_071394.2, NM_022111.3 [Q9HAW4-1]
UniGeneiHs.175613

3D structure databases

ProteinModelPortaliQ9HAW4
SMRiQ9HAW4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122015, 41 interactors
ELMiQ9HAW4
IntActiQ9HAW4, 22 interactors
MINTiQ9HAW4
STRINGi9606.ENSP00000312995

PTM databases

iPTMnetiQ9HAW4
PhosphoSitePlusiQ9HAW4

Polymorphism and mutation databases

BioMutaiCLSPN
DMDMi218512100

Proteomic databases

EPDiQ9HAW4
MaxQBiQ9HAW4
PaxDbiQ9HAW4
PeptideAtlasiQ9HAW4
PRIDEiQ9HAW4
ProteomicsDBi81451
81452 [Q9HAW4-2]
81453 [Q9HAW4-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251195; ENSP00000251195; ENSG00000092853 [Q9HAW4-3]
ENST00000318121; ENSP00000312995; ENSG00000092853 [Q9HAW4-1]
ENST00000373220; ENSP00000362317; ENSG00000092853 [Q9HAW4-2]
GeneIDi63967
KEGGihsa:63967
UCSCiuc001bzi.4 human [Q9HAW4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
63967
DisGeNETi63967
EuPathDBiHostDB:ENSG00000092853.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CLSPN
HGNCiHGNC:19715 CLSPN
HPAiHPA026305
HPA026312
MIMi605434 gene
neXtProtiNX_Q9HAW4
OpenTargetsiENSG00000092853
PharmGKBiPA134920757

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4156 Eukaryota
ENOG410Y041 LUCA
GeneTreeiENSGT00390000012738
HOVERGENiHBG080104
InParanoidiQ9HAW4
OMAiQDIREVR
OrthoDBiEOG091G0CRX
PhylomeDBiQ9HAW4
TreeFamiTF328925

Enzyme and pathway databases

ReactomeiR-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-176187 Activation of ATR in response to replication stress
R-HSA-5689880 Ub-specific processing proteases
R-HSA-5693607 Processing of DNA double-strand break ends
SIGNORiQ9HAW4

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CLSPN human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CLSPN

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
63967

Protein Ontology

More...
PROi
PR:Q9HAW4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000092853 Expressed in 79 organ(s), highest expression level in testis
CleanExiHS_CLSPN
ExpressionAtlasiQ9HAW4 baseline and differential
GenevisibleiQ9HAW4 HS

Family and domain databases

InterProiView protein in InterPro
IPR024146 Claspin
PANTHERiPTHR14396 PTHR14396, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCLSPN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HAW4
Secondary accession number(s): A6NFL4
, Q1RMC6, Q2KHM3, Q5VYG0, Q6P6H5, Q8IWI1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: December 16, 2008
Last modified: December 5, 2018
This is version 146 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again