Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 185 (07 Oct 2020)
Sequence version 1 (01 Mar 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Pleckstrin homology domain-containing family A member 5

Gene

PLEKHA5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9HAU0

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1660499, Synthesis of PIPs at the plasma membrane

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9HAU0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pleckstrin homology domain-containing family A member 5
Short name:
PH domain-containing family A member 5
Alternative name(s):
Phosphoinositol 3-phosphate-binding protein 2
Short name:
PEPP-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLEKHA5
Synonyms:KIAA1686, PEPP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000052126.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30036, PLEKHA5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607770, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9HAU0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
54477

Open Targets

More...
OpenTargetsi
ENSG00000052126

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134949896

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9HAU0, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLEKHA5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
48474955

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000538832 – 1116Pleckstrin homology domain-containing family A member 5Add BLAST1115

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei55PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki301Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei382PhosphoserineCombined sources1
Modified residuei410PhosphoserineCombined sources1
Modified residuei438PhosphothreonineCombined sources1
Modified residuei460PhosphothreonineCombined sources1
Modified residuei568PhosphoserineCombined sources1
Modified residuei607PhosphoserineCombined sources1
Modified residuei809PhosphoserineCombined sources1
Modified residuei855PhosphoserineCombined sources1
Modified residuei933PhosphoserineCombined sources1
Modified residuei937PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9HAU0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9HAU0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9HAU0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9HAU0

PeptideAtlas

More...
PeptideAtlasi
Q9HAU0

PRoteomics IDEntifications database

More...
PRIDEi
Q9HAU0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
20581
25347
69632
81434 [Q9HAU0-1]
81435 [Q9HAU0-2]
81436 [Q9HAU0-3]
81437 [Q9HAU0-4]
81438 [Q9HAU0-5]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q9HAU0-3 [Q9HAU0-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2872, 1 O-Linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9HAU0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9HAU0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in heart and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000052126, Expressed in female reproductive system and 238 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9HAU0, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9HAU0, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000052126, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
119982, 99 interactors

Protein interaction database and analysis system

More...
IntActi
Q9HAU0, 56 interactors

Molecular INTeraction database

More...
MINTi
Q9HAU0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000404296

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9HAU0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11116
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q9HAU0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9HAU0

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9HAU0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini10 – 43WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini56 – 89WW 2PROSITE-ProRule annotationAdd BLAST34
Domaini169 – 268PHPROSITE-ProRule annotationAdd BLAST100

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Specifically interacts with PI3P, PI4P, PI5P, and PI(3,5)P2.1 Publication

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0940, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155728

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_2673480_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9HAU0

KEGG Orthology (KO)

More...
KOi
K23797

Identification of Orthologs from Complete Genome Data

More...
OMAi
KGSHFPI

Database of Orthologous Groups

More...
OrthoDBi
71844at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9HAU0

TreeFam database of animal gene trees

More...
TreeFami
TF329090

Family and domain databases

Conserved Domains Database

More...
CDDi
cd13248, PH_PEPP1_2_3, 1 hit
cd00201, WW, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR040392, PKHA4/5/6/7_PH
IPR001202, WW_dom
IPR036020, WW_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169, PH, 1 hit
PF00397, WW, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233, PH, 1 hit
SM00456, WW, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51045, SSF51045, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50003, PH_DOMAIN, 1 hit
PS01159, WW_DOMAIN_1, 1 hit
PS50020, WW_DOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9HAU0-1) [UniParc]FASTAAdd to basket
Also known as: S

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAADLNLEWI SLPRSWTYGI TRGGRVFFIN EEAKSTTWLH PVTGEAVVTG
60 70 80 90 100
HRRQSTDLPT GWEEAYTFEG ARYYINHNER KVTCKHPVTG QPSQDNCIFV
110 120 130 140 150
VNEQTVATMT SEEKKERPIS MINEASNYNV TSDYAVHPMS PVGRTSRASK
160 170 180 190 200
KVHNFGKRSN SIKRNPNAPV VRRGWLYKQD STGMKLWKKR WFVLSDLCLF
210 220 230 240 250
YYRDEKEEGI LGSILLPSFQ IALLTSEDHI NRKYAFKAAH PNMRTYYFCT
260 270 280 290 300
DTGKEMELWM KAMLDAALVQ TEPVKRVDKI TSENAPTKET NNIPNHRVLI
310 320 330 340 350
KPEIQNNQKN KEMSKIEEKK ALEAEKYGFQ KDGQDRPLTK INSVKLNSLP
360 370 380 390 400
SEYESGSACP AQTVHYRPIN LSSSENKIVN VSLADLRGGN RPNTGPLYTE
410 420 430 440 450
ADRVIQRTNS MQQLEQWIKI QKGRGHEEET RGVISYQTLP RNMPSHRAQI
460 470 480 490 500
MARYPEGYRT LPRNSKTRPE SICSVTPSTH DKTLGPGAEE KRRSMRDDTM
510 520 530 540 550
WQLYEWQQRQ FYNKQSTLPR HSTLSSPKTM VNISDQTMHS IPTSPSHGSI
560 570 580 590 600
AAYQGYSPQR TYRSEVSSPI QRGDVTIDRR HRAHHPKHVY VPDRRSVPAG
610 620 630 640 650
LTLQSVSPQS LQGKTLSQDE GRGTLYKYRP EEVDIDAKLS RLCEQDKVVH
660 670 680 690 700
ALEEKLQQLH KEKYTLEQAL LSASQEIEMH ADNPAAIQTV VLQRDDLQNG
710 720 730 740 750
LLSTCRELSR ATAELERAWR EYDKLEYDVT VTRNQMQEQL DHLGEVQTES
760 770 780 790 800
AGIQRAQIQK ELWRIQDVME GLSKHKQQRG TTEIGMIGSK PFSTVKYKNE
810 820 830 840 850
GPDYRLYKSE PELTTVAEVD ESNGEEKSEP VSEIETSVVK GSHFPVGVVP
860 870 880 890 900
PRAKSPTPES STIASYVTLR KTKKMMDLRT ERPRSAVEQL CLAESTRPRM
910 920 930 940 950
TVEEQMERIR RHQQACLREK KKGLNVIGAS DQSPLQSPSN LRDNPFRTTQ
960 970 980 990 1000
TRRRDDKELD TAIRENDVKP DHETPATEIV QLKETEPQNV DFSKELKKTE
1010 1020 1030 1040 1050
NISYEMLFEP EPNGVNSVEM MDKERNKDKM PEDVTFSPQD ETQTANHKPE
1060 1070 1080 1090 1100
EHPEENTKNS VDEQEETVIS YESTPEVSRG NQTMAVKSLS PSPESSASPV
1110
PSTQPQLTEG SHFMCV
Length:1,116
Mass (Da):127,464
Last modified:March 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i327F792F644B9D48
GO
Isoform 2 (identifier: Q9HAU0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ

Show »
Length:1,174
Mass (Da):134,323
Checksum:iB82D29C6F281D311
GO
Isoform 3 (identifier: Q9HAU0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     616-650: LSQDEGRGTLYKYRPEEVDIDAKLSRLCEQDKVVH → WGREKVATATGAAEAVASDTHLPRTGSSSPSLLCV
     651-1116: Missing.

Show »
Length:650
Mass (Da):73,909
Checksum:i98FCFC6BD6243232
GO
Isoform 4 (identifier: Q9HAU0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

Show »
Length:1,179
Mass (Da):134,593
Checksum:iA7E7827DDD2166DC
GO
Isoform 5 (identifier: Q9HAU0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     785-840: Missing.

Show »
Length:1,060
Mass (Da):121,272
Checksum:iEC6B2DC66DC64F6A
GO
Isoform 6 (identifier: Q9HAU0-6) [UniParc]FASTAAdd to basket
Also known as: L

The sequence of this isoform differs from the canonical sequence as follows:
     275-275: K → KRITFNF
     615-615: T → TPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLDHQ
     616-616: L → MKENEPIITMVHTMIENSALRPQLYQQFLRQKSKISLYCL
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

Note: Specifically expressed in brain.Curated
Show »
Length:1,282
Mass (Da):146,896
Checksum:i06D1168C576FF684
GO
Isoform 7 (identifier: Q9HAU0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     77-1116: Missing.

Show »
Length:76
Mass (Da):8,723
Checksum:iDC9FF548141EE15E
GO
Isoform 8 (identifier: Q9HAU0-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-108: Missing.
     615-615: T → TMKENEPIITMVHTMIENSALRPQLYQQ
     800-800: E → EEEEVVPPRPPLPRSYDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKMYQVQGYPRNGSHC

Show »
Length:1,098
Mass (Da):125,523
Checksum:i3145FF2D1B42D710
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DJX4B4DJX4_HUMAN
Pleckstrin homology domain-containi...
PLEKHA5
977Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0JP02A0JP02_HUMAN
PLEKHA5 protein
PLEKHA5
874Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGJ6H0YGJ6_HUMAN
Pleckstrin homology domain-containi...
PLEKHA5
397Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1X3F5H1X3_HUMAN
Pleckstrin homology domain-containi...
PLEKHA5
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YG48H0YG48_HUMAN
Pleckstrin homology domain-containi...
PLEKHA5
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH70174 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA91742 differs from that shown. Reason: Frameshift.Curated
The sequence BAB14419 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB21777 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti311K → R in BAG57882 (PubMed:14702039).Curated1
Sequence conflicti534S → T in BAG57882 (PubMed:14702039).Curated1
Sequence conflicti627K → R in BAB14419 (PubMed:14702039).Curated1
Sequence conflicti736M → T in BAB14419 (PubMed:14702039).Curated1
Sequence conflicti970P → S in BAA91742 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0475141 – 108Missing in isoform 8. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_04686177 – 1116Missing in isoform 7. 1 PublicationAdd BLAST1040
Alternative sequenceiVSP_044678275K → KRITFNF in isoform 6. 1 Publication1
Alternative sequenceiVSP_009775615T → TPEELTLLLIKLRRQQAELS SIREHTLAQLMQLKLEAHSP KNEILSHHLQRNTIYLDHQ in isoform 2 and isoform 6. 2 Publications1
Alternative sequenceiVSP_047515615T → TMKENEPIITMVHTMIENSA LRPQLYQQ in isoform 8. 1 Publication1
Alternative sequenceiVSP_009776616 – 650LSQDE…DKVVH → WGREKVATATGAAEAVASDT HLPRTGSSSPSLLCV in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_044679616L → MKENEPIITMVHTMIENSAL RPQLYQQFLRQKSKISLYCL in isoform 6. 1 Publication1
Alternative sequenceiVSP_014595651 – 1116Missing in isoform 3. 1 PublicationAdd BLAST466
Alternative sequenceiVSP_009777785 – 840Missing in isoform 5. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_009778800E → EEEEVVPPRPPLPRSYDFTE QPPIIPPLPSDSSSLLCYSR GPVHLPEEKKMYQVQGYPRN GSHC in isoform 4, isoform 6 and isoform 8. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF302150 mRNA Translation: AAG22817.1
AB642244 mRNA Translation: BAL45489.1
AB051473 mRNA Translation: BAB21777.2 Different initiation.
AK001529 mRNA Translation: BAA91742.1 Frameshift.
AK023127 mRNA Translation: BAB14419.1 Different initiation.
AK294739 mRNA Translation: BAG57882.1
AL834259 mRNA Translation: CAD38934.1
AC024902 Genomic DNA No translation available.
AC087314 Genomic DNA No translation available.
AC091805 Genomic DNA No translation available.
AC092828 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96393.1
BC000969 mRNA Translation: AAH00969.1
BC044245 mRNA Translation: AAH44245.1
BC070174 mRNA Translation: AAH70174.1 Sequence problems.
BC013133 mRNA Translation: AAH13133.3
BC127092 mRNA Translation: AAI27093.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44840.2 [Q9HAU0-2]
CCDS55809.1 [Q9HAU0-7]
CCDS58213.1 [Q9HAU0-6]
CCDS58214.1 [Q9HAU0-8]
CCDS8682.1 [Q9HAU0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001137293.2, NM_001143821.2 [Q9HAU0-2]
NP_001177789.2, NM_001190860.2 [Q9HAU0-7]
NP_001243399.1, NM_001256470.1 [Q9HAU0-6]
NP_001243716.1, NM_001256787.1 [Q9HAU0-8]
NP_061885.2, NM_019012.5 [Q9HAU0-1]
XP_005253457.1, XM_005253400.1 [Q9HAU0-4]
XP_016874992.1, XM_017019503.1 [Q9HAU0-7]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000299275; ENSP00000299275; ENSG00000052126 [Q9HAU0-1]
ENST00000424268; ENSP00000400411; ENSG00000052126 [Q9HAU0-8]
ENST00000429027; ENSP00000404296; ENSG00000052126 [Q9HAU0-6]
ENST00000538714; ENSP00000439673; ENSG00000052126 [Q9HAU0-2]
ENST00000540972; ENSP00000439396; ENSG00000052126 [Q9HAU0-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54477

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54477

UCSC genome browser

More...
UCSCi
uc001rdz.5, human [Q9HAU0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF302150 mRNA Translation: AAG22817.1
AB642244 mRNA Translation: BAL45489.1
AB051473 mRNA Translation: BAB21777.2 Different initiation.
AK001529 mRNA Translation: BAA91742.1 Frameshift.
AK023127 mRNA Translation: BAB14419.1 Different initiation.
AK294739 mRNA Translation: BAG57882.1
AL834259 mRNA Translation: CAD38934.1
AC024902 Genomic DNA No translation available.
AC087314 Genomic DNA No translation available.
AC091805 Genomic DNA No translation available.
AC092828 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96393.1
BC000969 mRNA Translation: AAH00969.1
BC044245 mRNA Translation: AAH44245.1
BC070174 mRNA Translation: AAH70174.1 Sequence problems.
BC013133 mRNA Translation: AAH13133.3
BC127092 mRNA Translation: AAI27093.1
CCDSiCCDS44840.2 [Q9HAU0-2]
CCDS55809.1 [Q9HAU0-7]
CCDS58213.1 [Q9HAU0-6]
CCDS58214.1 [Q9HAU0-8]
CCDS8682.1 [Q9HAU0-1]
RefSeqiNP_001137293.2, NM_001143821.2 [Q9HAU0-2]
NP_001177789.2, NM_001190860.2 [Q9HAU0-7]
NP_001243399.1, NM_001256470.1 [Q9HAU0-6]
NP_001243716.1, NM_001256787.1 [Q9HAU0-8]
NP_061885.2, NM_019012.5 [Q9HAU0-1]
XP_005253457.1, XM_005253400.1 [Q9HAU0-4]
XP_016874992.1, XM_017019503.1 [Q9HAU0-7]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DKPNMR-A157-271[»]
BMRBiQ9HAU0
SMRiQ9HAU0
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi119982, 99 interactors
IntActiQ9HAU0, 56 interactors
MINTiQ9HAU0
STRINGi9606.ENSP00000404296

PTM databases

GlyConnecti2872, 1 O-Linked glycan (1 site)
iPTMnetiQ9HAU0
PhosphoSitePlusiQ9HAU0

Polymorphism and mutation databases

BioMutaiPLEKHA5
DMDMi48474955

Proteomic databases

EPDiQ9HAU0
jPOSTiQ9HAU0
MassIVEiQ9HAU0
MaxQBiQ9HAU0
PeptideAtlasiQ9HAU0
PRIDEiQ9HAU0
ProteomicsDBi20581
25347
69632
81434 [Q9HAU0-1]
81435 [Q9HAU0-2]
81436 [Q9HAU0-3]
81437 [Q9HAU0-4]
81438 [Q9HAU0-5]
TopDownProteomicsiQ9HAU0-3 [Q9HAU0-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
23890, 86 antibodies

Genome annotation databases

EnsembliENST00000299275; ENSP00000299275; ENSG00000052126 [Q9HAU0-1]
ENST00000424268; ENSP00000400411; ENSG00000052126 [Q9HAU0-8]
ENST00000429027; ENSP00000404296; ENSG00000052126 [Q9HAU0-6]
ENST00000538714; ENSP00000439673; ENSG00000052126 [Q9HAU0-2]
ENST00000540972; ENSP00000439396; ENSG00000052126 [Q9HAU0-7]
GeneIDi54477
KEGGihsa:54477
UCSCiuc001rdz.5, human [Q9HAU0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54477
DisGeNETi54477
EuPathDBiHostDB:ENSG00000052126.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLEKHA5
HGNCiHGNC:30036, PLEKHA5
HPAiENSG00000052126, Low tissue specificity
MIMi607770, gene
neXtProtiNX_Q9HAU0
OpenTargetsiENSG00000052126
PharmGKBiPA134949896

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0940, Eukaryota
GeneTreeiENSGT00940000155728
HOGENOMiCLU_2673480_0_0_1
InParanoidiQ9HAU0
KOiK23797
OMAiKGSHFPI
OrthoDBi71844at2759
PhylomeDBiQ9HAU0
TreeFamiTF329090

Enzyme and pathway databases

PathwayCommonsiQ9HAU0
ReactomeiR-HSA-1660499, Synthesis of PIPs at the plasma membrane
SignaLinkiQ9HAU0

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
54477, 8 hits in 873 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLEKHA5, human
EvolutionaryTraceiQ9HAU0

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PLEKHA5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54477
PharosiQ9HAU0, Tdark

Protein Ontology

More...
PROi
PR:Q9HAU0
RNActiQ9HAU0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000052126, Expressed in female reproductive system and 238 other tissues
ExpressionAtlasiQ9HAU0, baseline and differential
GenevisibleiQ9HAU0, HS

Family and domain databases

CDDicd13248, PH_PEPP1_2_3, 1 hit
cd00201, WW, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR040392, PKHA4/5/6/7_PH
IPR001202, WW_dom
IPR036020, WW_dom_sf
PfamiView protein in Pfam
PF00169, PH, 1 hit
PF00397, WW, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SM00456, WW, 2 hits
SUPFAMiSSF51045, SSF51045, 2 hits
PROSITEiView protein in PROSITE
PS50003, PH_DOMAIN, 1 hit
PS01159, WW_DOMAIN_1, 1 hit
PS50020, WW_DOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPKHA5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9HAU0
Secondary accession number(s): A0JP03
, B4DGS1, E9PHQ3, F5H0I0, Q6NSF8, Q86ST7, Q8N3K6, Q96DY9, Q9BVR4, Q9C0H7, Q9H924, Q9NVK8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 1, 2001
Last modified: October 7, 2020
This is version 185 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again